bch441-work-abc-units/scripts/BLAST.R
2017-10-23 12:37:09 -04:00

349 lines
11 KiB
R

# BLAST.R
#
# Purpose: Send off one BLAST search and return parsed list of results
# This script uses the BLAST URL-API
# (Application Programming Interface) at the NCBI.
# Read about the constraints here:
# https://ncbi.github.io/blast-cloud/dev/api.html
#
#
# Version: 2.1
# Date: 2016 09 - 2017 10
# Author: Boris Steipe
#
# Versions:
# 2.1 bugfix in BLAST(), bug was blanking non-split deflines;
# refactored parseBLASTalignment() to handle lists with multiple hits.
# 2.0 Completely rewritten because the interface completely changed.
# Code adpated in part from NCBI Perl sample code:
# $Id: web_blast.pl,v 1.10 2016/07/13 14:32:50 merezhuk Exp $
#
# 1.0 first version posted for BCH441 2016, based on BLAST - API
#
# ToDo:
#
# Notes: This is somewhat pedestrian, but apparently there are currently
# no R packages that contain such code.
#
# ==============================================================================
if (!require(httr, quietly = TRUE)) {
install.packages("httr")
library(httr)
}
BLAST <- function(q,
db = "refseq_protein",
nHits = 30,
E = 0.1,
limits = "",
rid = "",
quietly = FALSE,
myTimeout = 120) {
# Purpose:
# Basic BLAST search
# Version: 2.0
# Date: 2017-09
# Author: Boris Steipe
#
# Parameters:
# q: query - either a valid ID or a sequence
# db: "refseq_protein" by default,
# other legal valuses include: "nr", "pdb", "swissprot" ...
# nHits: number of hits to maximally return
# E: E-value cutoff. Do not return hits whose score would be expected
# to occur E or more times in a database of random sequence.
# limits: a valid ENTREZ filter
# rid: a request ID - to retrieve earleir search results
# quietly: controls printing of wait-time progress bar
# timeout: how much longer _after_ rtoe to wait for a result
# before giving up (seconds)
# Value:
# result: list of resulting hits and some metadata
EXTRAWAIT <- 10 # duration of extra wait cycles if BLAST search is not done
results <- list()
results$rid <- rid
results$rtoe <- 0
if (rid == "") { # if rid is not the empty string we skip the
# initial search and and proceed directly to retrieval
# prepare query, GET(), and parse rid and rtoe from BLAST server response
results$query <- paste0("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
"?",
"CMD=Put",
"&PROGRAM=", "blastp",
"&QUERY=", URLencode(q),
"&DATABASE=", db,
"&MATRIX=", "BLOSUM62",
"&EXPECT=", as.character(E),
"&HITLIST_SIZE=", as.character(nHits),
"&ALIGNMENTS=", as.character(nHits),
"&FORMAT_TYPE=Text")
if (limits != "") {
results$query <- paste0(
results$query,
"&ENTREZ_QUERY=", limits)
}
# send it off ...
response <- GET(results$query)
if (http_status(response)$category != "Success" ) {
stop(sprintf("PANIC: Can't send query. BLAST server status error: %s",
http_status(response)$message))
}
txt <- content(response, "text", encoding = "UTF-8")
patt <- "RID = (\\w+)" # match the request id
results$rid <- regmatches(txt, regexec(patt, txt))[[1]][2]
patt <- "RTOE = (\\d+)" # match the expected completion time
results$rtoe <- as.numeric(regmatches(txt, regexec(patt, txt))[[1]][2])
# Now we wait ...
if (quietly) {
Sys.sleep(results$rtoe)
} else {
cat(sprintf("BLAST is processing %s:\n", results$rid))
waitTimer(results$rtoe)
}
} # done sending query and retrieving rid, rtoe
# Enter an infinite loop to check for result availability
checkStatus <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
"?",
"CMD=Get",
"&RID=", results$rid,
"&FORMAT_TYPE=Text",
"&FORMAT_OBJECT=SearchInfo",
sep = "")
while (TRUE) {
# Check whether the result is ready
response <- GET(checkStatus)
if (http_status(response)$category != "Success" ) {
stop(sprintf("PANIC: Can't check status. BLAST server status error: %s",
http_status(response)$message))
}
txt <- content(response, "text", encoding = "UTF-8")
if (length(grep("Status=WAITING", txt)) > 0) {
myTimeout <- myTimeout - EXTRAWAIT
if (myTimeout <= 0) { # abort
cat("BLAST search not concluded before timeout. Aborting.\n")
cat(sprintf("You could check back later with rid \"%s\"\n",
results$rid))
return(results)
}
if (quietly) {
Sys.sleep(EXTRAWAIT)
} else {
cat(sprintf("Status: Waiting. Wait %d more seconds (max. %d more)",
EXTRAWAIT,
myTimeout))
waitTimer(EXTRAWAIT)
next
}
} else if (length(grep("Status=FAILED", txt)) > 0) {
cat("BLAST search returned status \"FAILED\". Aborting.\n")
return(results)
} else if (length(grep("Status=UNKNOWN", txt)) > 0) {
cat("BLAST search returned status \"UNKNOWN\".\n")
cat("This probably means the rid has expired. Aborting.\n")
return(results)
} else if (length(grep("Status=READY", txt)) > 0) { # Done
if (length(grep("ThereAreHits=yes", txt)) == 0) { # No hits
cat("BLAST search ready but no hits found. Aborting.\n")
return(results)
} else {
break # done ... retrieve search result
}
}
} # end result-check loop
# retrieve results from BLAST server
retrieve <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
"?",
"&CMD=Get",
"&RID=", results$rid,
"&FORMAT_TYPE=Text",
sep = "")
response <- GET(retrieve)
if (http_status(response)$category != "Success" ) {
stop(sprintf("PANIC: Can't retrieve. BLAST server status error: %s",
http_status(response)$message))
}
txt <- content(response, "text", encoding = "UTF-8")
# txt contains the whole set of results. Process:
# First, we strsplit() on linebreaks:
txt <- unlist(strsplit(txt, "\n"))
# The alignments range from the first line that begins with ">" ...
iFirst <- grep("^>", txt)[1]
# ... to the last line that begins with "Sbjct"
x <- grep("^Sbjct", txt)
iLast <- x[length(x)]
# Get the alignments block
txt <- txt[iFirst:iLast]
# Drop empty lines
txt <- txt[!(nchar(txt) == 0)]
# A line that ends "]" but does not begin ">" seems to be a split
# defline ... eg.
# [1] ">XP_013349208.1 AUEXF2481DRAFT_695809 [Aureobasidium subglaciale "
# [2] "EXF-2481]"
# Merge these lines to the preceding lines and delete them.
#
x <- which(grepl("]$", txt) & !(grepl("^>", txt)))
if (length(x) > 0) {
txt[x-1] <- paste0(txt[x-1], txt[x])
txt <- txt[-x]
}
# Special case: there may be multiple deflines when the BLAST hit is to
# redundant, identical sequences. Keep only the first instance.
iKeep <- ! grepl("^>", txt)
x <- rle(iKeep)
x$positions <- cumsum(x$lengths)
i <- which(x$lengths > 1 & x$values == FALSE)
if (length(i) > 0) {
firsts <- x$positions[i] - x$lengths[i] + 1
iKeep[firsts] <- TRUE
txt <- txt[iKeep]
}
# After this preprocessing the following should be true:
# - Every alignment block begins with a defline in which the
# first character is ">"
# - There is only one defline in each block.
# - Lines are not split.
# Make a dataframe of first and last indices of alignment blocks
x <- grep("^>", txt)
blocks <- data.frame(iFirst = x,
iLast = c((x[-1] - 1), length(txt)))
# Build the hits list by parsing the blocks
results$hits <- list()
for (i in seq_len(nrow(blocks))) {
thisBlock <- txt[blocks$iFirst[i]:blocks$iLast[i]]
results$hits[[i]] <- parseBLASTalignment(thisBlock)
}
return(results)
}
parseBLASTalignment <- function(hits, idx) {
# Parse one BLAST hit from a BLAST result
# Parameters:
# hits list contains the BLAST hits
# idx int index of the requested hit
# Value:
# list $def chr defline
# $accession chr accession number
# $organism chr complete organism definition
# $species chr binomial species
# $E num E value
# $lengthAli num length of the alignment
# $nIdentitites num number of identities
# $nGaps num number of gaps
# $Qbounds num 2-element vector of query start-end
# $Sbounds num 2-element vector of subject start-end
# $Qseq chr query sequence
# $midSeq chr midline string
# $Sseq chr subject sequence
h <- list()
hit <- hits$hits[[idx]]
# FASTA defline
h$def <- hit$def
# accesion number (ID), use the first if there are several, separated by "|"
patt <- "^>(.+?)(\\s|\\|)" # from ">" to space or "|"
h$accession <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
# organism
patt <- "\\[(.+)]"
h$organism <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
# species
x <- unlist(strsplit(h$organism, "\\s+"))
if (length(x) >= 2) {
h$species <- paste(x[1], x[2])
} else if (length(x) == 1) {
h$species <- paste(x[1], "sp.")
} else {
h$species <- NA
}
# E-value
h$E <- hit$E
# length of hit and # identities
h$lengthAli <- hit$lengthAli
h$nIdentities <- hit$nIdentities
# number of gaps
h$nGaps <- hit$nGaps
# first and last positions
h$Qbounds <- hit$Qbounds
h$Sbounds <- hit$Sbounds
# aligned sequences
h$Qseq <- hit$Qseq
h$midSeq <- hit$midSeq
h$Sseq <- hit$Sseq
return(h)
}
# ==== TESTS ===================================================================
# define query:
# q <- paste("IYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHI", # Mbp1 APSES domain sequence
# "LKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQ",
# "GTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASP",
# sep="")
# or ...
# q <- "NP_010227" # refseq ID
#
# test <- BLAST(q,
# nHits = 100,
# E = 0.001,
# rid = "",
# limits = "txid4751[ORGN]")
# length(test$hits)
# [END]