# BIN-PHYLO-Data_preparation.R # # Purpose: A Bioinformatics Course: # R code accompanying the BIN-PHYLO-Data_preparation unit. # # Version: 1.0 # # Date: 2017 10 31 # Author: Boris Steipe (boris.steipe@utoronto.ca) # # Versions: # 1.0 First 2017 version # 0.1 First code copied from 2016 material. # # # TODO: # # # == DO NOT SIMPLY source() THIS FILE! ======================================= # # If there are portions you don't understand, use R's help system, Google for an # answer, or ask your instructor. Don't continue if you don't understand what's # going on. That's not how it works ... # # ============================================================================== #TOC> ========================================================================== #TOC> #TOC> Section Title Line #TOC> --------------------------------------------------- #TOC> 1 Preparations 41 #TOC> 2 Fetching sequences 78 #TOC> 3 Multiple Sequence Alignment 119 #TOC> 4 Reviewing and Editing Alignments 138 #TOC> 4.1 Masking workflow 154 #TOC> #TOC> ========================================================================== # = 1 Preparations ======================================================== # You need to reload your protein database, including changes that might have # been made to the reference files. If you have worked with the prerequiste # units, you should have a script named "makeProteinDB.R" that will create the # myDB object with a protein and feature database. Ask for advice if not. source("makeProteinDB.R") # Load packages we need if (! require(Biostrings, quietly=TRUE)) { if (! exists("biocLite")) { source("https://bioconductor.org/biocLite.R") } biocLite("Biostrings") library(Biostrings) } # Package information: # library(help = Biostrings) # basic information # browseVignettes("Biostrings") # available vignettes # data(package = "Biostrings") # available datasets if (! require(msa, quietly=TRUE)) { if (! exists("biocLite")) { source("https://bioconductor.org/biocLite.R") } biocLite("msa") library(msa) } # Package information: # library(help = msa) # basic information # browseVignettes("msa") # available vignettes # data(package = "msa") # available datasets # = 2 Fetching sequences ================================================== # myDB contains the ten Mbp1 orthologues from the reference species and the Mbp1 # RBM for MYSPE. We will construct a phylogenetic tree from the proteins' APSES # domains. You have annotated their ranges as a feature. The following code # retrieves the sequences from myDB. You have seen similar code in other units. sel <- grep("^MBP1_", myDB$protein$name) (proNames <- myDB$protein$name[sel]) (proIDs <- myDB$protein$ID[sel]) (sel <- myDB$feature$ID[myDB$feature$name == "APSES fold"]) (fanIDs <- myDB$annotation$ID[myDB$annotation$proteinID %in% proIDs & # %in% ! myDB$annotation$featureID == sel]) # == ! # Why? APSI <- character(length(fanIDs)) for (i in seq_along(fanIDs)) { sel <- myDB$annotation$ID == fanIDs[i] # get the feature row index proID <- myDB$annotation$proteinID[sel] # get its protein ID start <- myDB$annotation$start[sel] # get start ... end <- myDB$annotation$end[sel] # ... and end sel <- myDB$protein$ID == proID # get the protein row index ... # ... and the sequence APSI[i] <- substring(myDB$protein$sequence[sel], start, end) names(APSI)[i] <- (myDB$protein$name[sel]) } head(APSI) # Let's add the E.coli Kila-N domain sequence as an outgroup, for rooting our # phylogenetic tree (see the unit's Wiki page for details on the sequence). APSI <- c(APSI, "IDGEIIHLRAKDGYINATSMCRTAGKLLSDYTRLKTTQEFFDELSRDMGIPISELIQSFKGGRPENQGTWVHPDIAINLAQ") names(APSI)[length(APSI)] <- "KILA_ESCCO" tail(APSI) # = 3 Multiple Sequence Alignment ========================================= # This vector of sequences with named elements fulfills the requirements to be # imported as a Biostrings object - an AAStringSet - which we need as input for # the MSA algorithms in Biostrings. # APSESSet <- AAStringSet(APSI) APSESMsa <- msaMuscle(APSESSet, order = "aligned") # Nb. msaMuscle() sometimes fails - reproducibly, but I am not sure why. If # that happens in your case, just use msaClustalOmega() instead. # inspect the alignment. writeALN(APSESMsa) # What do you think? Is this a good alignment for phylogenetic inference? # = 4 Reviewing and Editing Alignments ==================================== # Head back to the Wiki page for this unit and read up on the background # first. # Let's mask out all columns that have observations for # less than 1/3 of the sequences in the dataset. This # means they have more than round(nrow(msaSet) * (2/3)) # hyphens in a column. # # We take all sequences, split them into single # characters, and put them into a matrix. Then we # go through the matrix, column by column and decide # whether we want to include that column. # == 4.1 Masking workflow ================================================== # get the length of the alignment (lenAli <- APSESMsa@unmasked@ranges@width[1]) # initialize a matrix that can hold all characters # individually msaMatrix <- matrix(character(nrow(APSESMsa) * lenAli), ncol = lenAli) # assign the correct rownames rownames(msaMatrix) <- APSESMsa@unmasked@ranges@NAMES for (i in 1:nrow(APSESMsa)) { msaMatrix[i, ] <- unlist(strsplit(as.character(APSESMsa@unmasked[i]), "")) } # inspect the result msaMatrix[1:7, 1:14] # Now let's make a logical vector with an element for each column that selects # which columns should be masked out. # The number of hyphens in a column is easy to count. Consider: msaMatrix[ , 20] msaMatrix[ , 20] == "-" sum(msaMatrix[ , 20] == "-") # Thus filling our logical vector is simple: # initialize a mask colMask <- logical(ncol(msaMatrix)) # define the threshold for rejecting a column limit <- round(nrow(APSESMsa) * (2/3)) # iterate over all columns, and write TRUE if there are less-or-equal to "limit" # hyphens, FALSE if there are more - i.e. TRUE columns will be used fr analysis # and FALSE columns will be rejected. for (i in 1:ncol(msaMatrix)) { count <- sum(msaMatrix[ , i] == "-") colMask[i] <- count <= limit # TRUE if less-or-equal to limit, FALSE if not } # Inspect the mask colMask # How many positions are being kept? sum(colMask) cat(sprintf("We are masking %4.2f %% of alignment columns.\n", 100 * (1 - (sum(colMask) / length(colMask))))) # Next, we use colMask to remove the masked columns from the matrix # in one step: maskedMatrix <- msaMatrix[ , colMask] # check: ncol(maskedMatrix) # ... then collapse each row of single characters back into a string ... APSESphyloSet <- character() for (i in 1:nrow(maskedMatrix)) { APSESphyloSet[i] <- paste(maskedMatrix[i, ], collapse="") } names(APSESphyloSet) <- rownames(maskedMatrix) # inspect ... writeALN(APSESphyloSet) # As you see, we have removed a three residue insertion from MBP1_NEUCR, and # several indels from the KILA_ESCCO outgroup sequence. # We save the aligned, masked domains to a file in multi-FASTA format. writeMFA(APSESphyloSet, myCon = "APSESphyloSet.mfa") # [END]