# BIN-PHYLO-Data_preparation.R # # Purpose: A Bioinformatics Course: # R code accompanying the BIN-PHYLO-Data_preparation unit. # # Version: 0.1 # # Date: 2017 08 28 # Author: Boris Steipe (boris.steipe@utoronto.ca) # # Versions: # 0.1 First code copied from 2016 material. # # TODO: # # # == DO NOT SIMPLY source() THIS FILE! ======================================= # If there are portions you don't understand, use R's help system, Google for an # answer, or ask your instructor. Don't continue if you don't understand what's # going on. That's not how it works ... # ============================================================================== # = 1 ___Section___ # ============================================================================== # PART ONE: Choosing sequences # ============================================================================== # Start by loading libraries. You already have the packages installed. library(Biostrings) library(msa) library(stringr) # What is the latest version of myDB that you have saved? list.files(pattern = "myDB.*") # ... load it (probably myDB.05.RData - if not, change the code below). load("myDB.05.RData") # The database contains the ten Mbp1 orthologues from the reference species # and the Mbp1 RBM for YFO. # # We will construct a phylogenetic tree from the proteins' APSES domains. # You have annotated their ranges as a feature. # Collect APSES domain sequences from your database. The function # dbGetFeatureSequence() retrieves the sequence that is annotated for a feature # from its start and end coordinates. Try: dbGetFeatureSequence(myDB, "MBP1_SACCE", "APSES fold") # Lets put all APSES sequences into a vector: APSESnames <- myDB$protein$name[grep("^MBP1_", myDB$protein$name)] APSES <- character(length(APSESnames)) for (i in 1:length(APSESnames)) { APSES[i] <- dbGetFeatureSequence(myDB, APSESnames[i], "APSES fold") } # Let's name the rows of our vector with the BiCode part of the protein name. # This is important so we can keep track of which sequence is which. We use the # gsub() funcion to substitute "" for "MBP1_", thereby deleting this prefix. names(APSES) <- gsub("^MBP1_", "", APSESnames) # inspect the result: what do you expect? Is this what you expect? head(APSES) # Let's add the E.coli Kila-N domain sequence as an outgroup, for rooting our # phylogegetic tree (see the Assignment Course Wiki page for details on the # sequence). APSES[length(APSES) + 1] <- "IDGEIIHLRAKDGYINATSMCRTAGKLLSDYTRLKTTQEFFDELSRDMGIPISELIQSFKGGRPENQGTWVHPDIAINLAQ" names(APSES)[length(APSES)] <- "ESCCO" # ============================================================================== # PART TWO: Multiple sequence alignment # ============================================================================== # This vector of sequences with named elements fulfills the requirements to be # imported as a Biostrings object - an AAStringSet - which we need as input for # the MSA algorithms in Biostrings. # APSESSeqSet <- AAStringSet(APSES) APSESMsaSet <- msaMuscle(APSESSeqSet, order = "aligned") # inspect the alignment. writeSeqSet(APSESMsaSet, format = "ali") # What do you think? Is this a good alignment for phylogenetic inference? # ============================================================================== # PART THREE: reviewing and editing alignments # ============================================================================== # Head back to the assignment 7 course wiki page and read up on the background # first. # # Let's mask out all columns that have observations for # less than 1/3 of the sequences in the dataset. This # means they have more than round(nrow(msaSet) * (2/3)) # hyphens in a column. # # We take all sequences, split them into single # characters, and put them into a matrix. Then we # go through the matrix, column by column and decide # whether we want to include that column. # Step 1. Go through this by hand... # get the length of the alignment lenAli <- APSESMsaSet@unmasked@ranges@width[1] # initialize a matrix that can hold all characters # individually msaMatrix <- matrix(character(nrow(APSESMsaSet) * lenAli), ncol = lenAli) # assign the correct rownames rownames(msaMatrix) <- APSESMsaSet@unmasked@ranges@NAMES for (i in 1:nrow(APSESMsaSet)) { seq <- as.character(APSESMsaSet@unmasked[i]) msaMatrix[i, ] <- unlist(strsplit(seq, "")) } # inspect the result msaMatrix[1:5, ] # Now let's make a logical vector with an element # for each column that selects which columns should # be masked out. # To count the number of elements in a vector, R has # the table() function. For example ... table(msaMatrix[ , 1]) table(msaMatrix[ , 10]) table(msaMatrix[ , 20]) table(msaMatrix[ , 30]) # Since the return value of table() is a named vector, where # the name is the element that was counted in each slot, # we can simply get the counts for hyphens from the # return value of table(). We don't even need to assign # the result to an intermediate variable, but we # can attach the selection via square brackets, # i.e.: ["-"], directly to the function call: table(msaMatrix[ , 1])["-"] # ... to get the number of hyphens. And we can compare # whether it is eg. > 4. table(msaMatrix[ , 1])["-"] > 4 # Thus filling our logical vector is really simple: # initialize the mask colMask <- logical(lenAli) # define the threshold for rejecting a column limit <- round(nrow(APSESMsaSet) * (2/3)) # iterate over all columns, and write TRUE if there are less-or-equal to "limit" # hyphens, FALSE if there are more. for (i in 1:lenAli) { count <- table(msaMatrix[ , i])["-"] if (is.na(count)) { # No hyphen count <- 0 } colMask[i] <- count <= limit } # inspect the mask colMask # How many positions were masked? R has a simple trick # to count the number of TRUE and FALSE in a logical # vector. If a logical TRUE or FALSE is converted into # a number, it becomes 1 or 0 respectively. If we use # the sum() function on the vector, the conversion is # done implicitly. Thus ... sum(colMask) # ... gives the number of TRUE elements. cat(sprintf("We are masking %4.2f %% of alignment columns.\n", 100 * (1 - (sum(colMask) / length(colMask))))) # Next, we use colMask to remove the masked columns from the matrix # in one step: maskedMatrix <- msaMatrix[ , colMask] # check: ncol(maskedMatrix) # ... then collapse each row back into a sequence ... apsMaskedSeq <- character() for (i in 1:nrow(maskedMatrix)) { apsMaskedSeq[i] <- paste(maskedMatrix[i, ], collapse="") } names(apsMaskedSeq) <- rownames(maskedMatrix) # ... and read it back into an AAStringSet object apsMaskedSet <- AAStringSet(apsMaskedSeq) # inspect ... writeSeqSet(apsMaskedSet, format = "ali") # Step 2. Turn this code into a function... # Even though the procedure is simple, doing this more than once is tedious and # prone to errors. I have assembled the steps we just went through into a # function maskSet() and put it into the utilities.R file, from where it has # been loaded when you started this sesssion. maskSet # Check that the function gives identical results # to what we did before by hand: identical(apsMaskedSet, maskSet(APSESMsaSet)) # The result must be TRUE. If it's not TRUE you have # an error somewhere. # We save the aligned, masked domains to a file in multi-FASTA format. writeSeqSet(maskSet(APSESMsaSet), file = "APSES.mfa", format = "mfa") # = 1 Tasks # [END]