# RPR-RegEx.R # # Purpose: A Bioinformatics Course: # R code accompanying the RPR-RegEx unit # # Version: 0.1 # # Date: 2017 08 25 # Author: Boris Steipe (boris.steipe@utoronto.ca) # # V 0.1 First code # # TODO: # # # == HOW TO WORK WITH LEARNING UNIT FILES ====================================== # # DO NOT SIMPLY source() THESE FILES! # # If there are portions you don't understand, use R's help system, Google for an # answer, or ask your instructor. Don't continue if you don't understand what's # going on. That's not how it works ... # # ============================================================================== #TOC> ========================================================================== #TOC> #TOC> Section Title Line #TOC> ---------------------------------------------- #TOC> 1 A regex example 44 #TOC> 2 Counting lines 111 #TOC> 2.1 Counting C-alpha atoms only 128 #TOC> 3 Code Solutions 144 #TOC> 3.1 Counting atoms 146 #TOC> 3.2 Counting C-alpha records 160 #TOC> #TOC> ========================================================================== #TOC> #TOC> #TOC> #TOC> # = 1 A regex example ===================================================== # The canonical FASTA version of yeast Mbp1 at Uniprot s <- ">sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 MSNQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLK ETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASPPPAPKHHHA SKVDRKKAIRSASTSAIMETKRNNKKAEENQFQSSKILGNPTAAPRKRGRPVGSTRGSRR KLGVNLQRSQSDMGFPRPAIPNSSISTTQLPSIRSTMGPQSPTLGILEEERHDSRQQQPQ QNNSAQFKEIDLEDGLSSDVEPSQQLQQVFNQNTGFVPQQQSSLIQTQQTESMATSVSSS PSLPTSPGDFADSNPFEERFPGGGTSPIISMIPRYPVTSRPQTSDINDKVNKYLSKLVDY FISNEMKSNKSLPQVLLHPPPHSAPYIDAPIDPELHTAFHWACSMGNLPIAEALYEAGTS IRSTNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLHETVFDIDSQSQTVIHHIVKRKSTTP SAVYYLDVVLSKIKDFSPQYRIELLLNTQDKNGDTALHIASKNGDVVFFNTLVKMGALTT ISNKEGLTANEIMNQQYEQMMIQNGTNQHVNSSNTDLNIHVNTNNIETKNDVNSMVIMSP VSPSDYITYPSQIATNISRNIPNVVNSMKQMASIYNDLHEQHDNEIKSLQKTLKSISKTK IQVSLKTLEVLKESSKDENGEAQTNDDFEILSRLQEQNTKKLRKRLIRYKRLIKQKLEYR QTVLLNKLIEDETQATTNNTVEKDNNTLERLELAQELTMLQLQRKNKLSSLVKKFEDNAK IHKYRRIIREGTEMNIEEVDSSLDVILQTLIANNNKNKGAEQIITISNANSHA" nchar(s) # Must be 969 # Task: Fetch the Uniprot ID by retrieving the first string that appears between # two vertical bars ("pipes") in the header record. # # Develop the regular expression: # Just five characters returned, so we know we are using patt <- "^>(.{5})" # the right functions regmatches(s, regexec(patt, s, perl = TRUE))[[1]][2] patt <- "^>(.*)|" # everything to the pipe character regmatches(s, regexec(patt, s, perl = TRUE))[[1]][2] # Ooops - "|" is a metacharacter - we must escape it patt <- "^>(.*)\|" # using "\|" # Ooops - that's not how we escape: must double the \ to send a literal # "\" plus the character "|" to the regex engine. patt <- "^>(.*)\\|" # using "\\|" regmatches(s, regexec(patt, s, perl = TRUE))[[1]][2] # Good. Now let's first match everything that is not a "|", then match a "|" patt <- "^>([^|]*)\\|" regmatches(s, regexec(patt, s, perl = TRUE))[[1]][2] # the same thing again, but capture the second match. And insist that there # must be at least one character captured patt <- "^>[^|]*\\|([^|]+)\\|" # Analyze this pattern: # ^ anchor the match at the beginning of the line # > ">" must be the first character # [^|]* all-characters-except-a-vertical-bar, 0 or more times because # we don't know what other versions of the string "sp" # might appear. Note that within the brackets "|" is NOT a # metacharacter. # \\| "|" character: ouside of square brackets "|" is a metacharacter # and means "OR"; we need to escape it to match a literal "|". # ( open parenthesis: capture what comes next ... # [^|]+ all-characters-except-a-vertical-bar, 1 or more times # ) close parenthesis: stop capturing here # \\| second "|" character, escaped regmatches(s, regexec(patt, s, perl = TRUE))[[1]][2] # = 2 Counting lines ====================================================== # Task: Write a function that returns the number of atoms in a PDB file. Call it # atomCount(). Sample data is here: myPDB <- readLines("./data/0TST.pdb") # Specification: # Read a file from its path given as the only argument. # Return the number of lines in that file that begin with "ATOM " # or with "HETATM". # Try this. Solution code is at the end of this file. Don't peek. atomCount("./data/0TST.pdb") # must return 6 # == 2.1 Counting C-alpha atoms only ======================================= # Task: write a function based on the previous one that matches only CA records, # i.e. it can be used to count the number of amino acids. Don't get # fooled by calcium atoms, or the string CA appearing elsewhere. # cf. https://www.wwpdb.org/documentation/file-format-content/format33/sect9.html#ATOM # Specification: # Read a file from its path given as the only argument. # Return the number of lines in that file that have a C-alpha atom. # Try this. Solution code is at the end of this file. Don't peek. CAcount("./data/0TST.pdb") # must return 1 # = 3 Code Solutions ====================================================== # == 3.1 Counting atoms ==================================================== atomCount <- function(IN) { # count the number of atoms in a PDB formatted file # Parameters: # IN chr path of the file to read # Value: # numeric number of lines that match "^ATOM " or "^HETATM" x <- readLines(IN) patt <- "(^ATOM )|(^HETATM)" return(length(grep(patt, x))) } # == 3.2 Counting C-alpha records ========================================== CAcount <- function(IN) { # count the number of C-alpha atoms in a PDB formatted file # Parameters: # IN chr path of the file to read # Value: # numeric number of lines that match " CA " in position 13 - 16 of # an ATOM record. x <- readLines(IN) patt <- "^ATOM ...... CA " return(length(grep(patt, x))) } # [END]