# tocID <- "FND-STA-Significance.R" # # ---------------------------------------------------------------------------- # # PATIENCE ... # # Do not yet work wih this code. Updates in progress. Thank you. # # boris.steipe@utoronto.ca # # ---------------------------------------------------------------------------- # # # Purpose: A Bioinformatics Course: # R code accompanying the FND-STA-Significance unit. # # Version: 1.2 # # Date: 2017 09 - 2019 01 # Author: Boris Steipe (boris.steipe@utoronto.ca) # # Versions: # 1.2 Update set.seed() usage # 1.1 Corrected treatment of empirical p-value # 1.0 First contents # # TODO: # # # == DO NOT SIMPLY source() THIS FILE! ======================================= # # If there are portions you don't understand, use R's help system, Google for an # answer, or ask your instructor. Don't continue if you don't understand what's # going on. That's not how it works ... # ============================================================================== #TOC> ========================================================================== #TOC> #TOC> Section Title Line #TOC> ------------------------------------------------------------------ #TOC> 1 Significance and p-value 43 #TOC> 1.1 Significance levels 54 #TOC> 1.2 probability and p-value 71 #TOC> 1.2.1 p-value illustrated 103 #TOC> 2 One- or two-sided 158 #TOC> 3 Significance by integration 198 #TOC> 4 Significance by simulation or permutation 204 #TOC> 5 Final tasks 312 #TOC> #TOC> ========================================================================== # = 1 Significance and p-value ============================================ # The idea of the probability of an event has a precise mathematical # interpretation, but how is it useful to know the probability? Usually we are # interested in whether we should accept or reject a hypothesis based on the # observations we have. A rational way to do this is to say: if the probability # of observing the data is very small under the null-hypothesis, then we will # assume the observation is due to something other than the null-hypothesis. But # what do we mean by the "probability of our observation"? And what is "very # small"? # == 1.1 Significance levels =============================================== # A "very small" probability is purely a matter of convention - a cultural # convention. In the biomedical field we usually call probabilities of less then # 0.05 (5%) small enough to reject the null-hypothesis. Thus we call # observations with a probability of less than 0.05 "significant" and if we want # to highlight this in text or in a graph, we often mark them with an asterisk # (*). Also we often call observations with a probability of less than 0.01 # "highly significant" and mark them with two asterisks (**). But there is no # special significance in these numbers, the cutoff point for significance could # also be 0.0498631, or 0.03, or 1/(pi^3). 0.05 is just the value that the # British statistician Ronald Fisher happened to propose for this purpose in # 1925. Incidentally, Fisher later recommended to use different cutoffs for # different purposes (cf. # https://en.wikipedia.org/wiki/Statistical_significance). # == 1.2 probability and p-value =========================================== # But what do we even mean by the probability of an observation? # Assume I am drawing samples from a normal distribution with a mean of 0 and a # standard deviation of 1. The sample I get is ... set.seed(sqrt(5)) x <- rnorm(1) set.seed(NULL) print(x, digits = 22) # [1] -0.8969145466249813791748 # So what's the probability of that number? Obviously, the probability of # getting exactly this number is very, very, very small. But also obviously, # this does not mean that observing this number is in any way significant - we # always observe some number. That's not what we mean in this case. There are # several implicit assumptions when we speak of the probability of an # observation: # 1: the observation can be compared to a probability distribution; # 2: that distribution can be integrated between any specific value # and its upper and lower bounds (or +- infinity). # Then what we really mean by the probability of an observation in the context # of that distribution is: the probability of observing that value, or a value # more extreme than the one we have. We call this the p-value. Note that we are # not talking about an individual number anymore, we are talking about the area # under the curve between our observation and the upper (or lower) bound of the # curve, as a fraction of the whole. # === 1.2.1 p-value illustrated # Let's illustrate. First we draw a million random values from our # standard, normal distribution: N <- 1e6 # one million set.seed(112358) # set RNG seed for repeatable randomness r <- rnorm(N) # N values from a normal distribution set.seed(NULL) # reset the RNG # Let's see what the distribution looks like: (h <- hist(r)) # The histogram details are now available in the list h - e.g. h$counts # Where is the value we have drawn previously? abline(v = x, col = "#EE0000") # How many values are smaller? sum(r < x) # Let's color the bars: # first, make a vector of red and green colors for the bars with breaks # smaller and larger then x, white for the bar that contains x ... hCol <- rep("#EE000044", sum(h$breaks < x) - 1) hCol <- c(hCol, "#FFFFFFFF") hCol <- c(hCol, rep("#00EE0044", sum(h$breaks > x) - 1)) # ... then plot the histogram, with colored bars ... hist(r, col = hCol) # ... add two colored rectangles into the white bar ... idx <- sum(h$breaks < x) xMin <- h$breaks[idx] xMax <- h$breaks[idx + 1] y <- h$counts[idx] rect(xMin, 0, x, y, col = "#EE000044", border = TRUE) rect(x, 0, xMax, y, col = "#00EE0044", border = TRUE) # ... and a red line for our observation. abline(v = x, col = "#EE0000", lwd = 2) # The p-value of our observation is the area colored red as a fraction of the # whole histogram (red + green). # Task: # Explain how the expression sum(r < x) works to give us a count of values # with the property we are looking for. # Task: # Write an expression to estimate the probability that a value # drawn from the vector r is less-or-equal to x. The result you get # will depend on the exact values that went into the vector r but it should # be close to 0.185 That expression is the p-value associated with x. # = 2 One- or two-sided =================================================== # The shape of our histogram confirms that the rnorm() function has returned # values that appear distributed according to a normal distribution. In a normal # distribution, readily available tables tell us that 5% of the values (i.e. our # significance level) lie 1.96 (or approximately 2) standard deviations away # from the mean. Is this the case here? How many values in our vector r are # larger than 1.96? sum(r > 1.96) # [1] 24589 # Wait - that's about 2.5% , not 5% as expected. Why? # The answer is: we have to be careful with two-sided distributions. 2 standard # deviations away from the mean means either larger or smaller than 1.96 . This # can give rise to errors. If we are simply are interested in outliers, no # matter larger or smaller, then the 1.96 SD cutoff for significance is correct. # But if we are specifically interested in, say, larger values, because a # smaller value is not meaningful, then the significance cutoff, expressed as # standard deviations, is relaxed. We can use the quantile function to see what # the cutoff values are: quantile(r) quantile(r, probs = c(0.025, 0.975)) # for the symmetric 2.5% boundaries # close to ± 1.96, as expected quantile(r, probs = 0.95) # for the single 5% boundary # close to 1.64 . Check counts to confirm: sum(r > quantile(r, probs = 0.95)) # [1] 50000 # which is 5%, as expected. # To summarize: when we evaluate the significance of an event, we divide a # probability distribution into two parts at the point where the event was # observed. We then ask whether the integral over the more extreme part is less # or more than 5% of the whole. If it is less, we deem the event to be # significant. # # = 3 Significance by integration ========================================= # If the underlying probability distribution can be analytically or numerically # integrated, the siginificance of an observation can be directly computed. # = 4 Significance by simulation or permutation =========================== # But whether the integration is correct, or relies on assumptions that may not # be warranted for biological data, can be a highly technical question. # Fortunately, we can often simply run a simulation, a random resampling, or a # permutation and then count the number of outcomes, just as we did with our # rnorm() samples. We call this an empirical p-value. (Actually, the "empirical # p-value" is defined as (Nobs + 1) / (N + 1). ) # Here is an example. Assume you have a protein sequence and # you speculate that positively charged residues are close to negatively charged # residues to balance charge locally. A statistic that would capture this is the # mean minimum distance between all D,E residues and the closest R,K,H # residue. Let's compute this for the sequence of yeast Mbp1. MBP1 <- paste0("MSNQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLK", "ETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASPPPAPKHHHA", "SKVDRKKAIRSASTSAIMETKRNNKKAEENQFQSSKILGNPTAAPRKRGRPVGSTRGSRR", "KLGVNLQRSQSDMGFPRPAIPNSSISTTQLPSIRSTMGPQSPTLGILEEERHDSRQQQPQ", "QNNSAQFKEIDLEDGLSSDVEPSQQLQQVFNQNTGFVPQQQSSLIQTQQTESMATSVSSS", "PSLPTSPGDFADSNPFEERFPGGGTSPIISMIPRYPVTSRPQTSDINDKVNKYLSKLVDY", "FISNEMKSNKSLPQVLLHPPPHSAPYIDAPIDPELHTAFHWACSMGNLPIAEALYEAGTS", "IRSTNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLHETVFDIDSQSQTVIHHIVKRKSTTP", "SAVYYLDVVLSKIKDFSPQYRIELLLNTQDKNGDTALHIASKNGDVVFFNTLVKMGALTT", "ISNKEGLTANEIMNQQYEQMMIQNGTNQHVNSSNTDLNIHVNTNNIETKNDVNSMVIMSP", "VSPSDYITYPSQIATNISRNIPNVVNSMKQMASIYNDLHEQHDNEIKSLQKTLKSISKTK", "IQVSLKTLEVLKESSKDENGEAQTNDDFEILSRLQEQNTKKLRKRLIRYKRLIKQKLEYR", "QTVLLNKLIEDETQATTNNTVEKDNNTLERLELAQELTMLQLQRKNKLSSLVKKFEDNAK", "IHKYRRIIREGTEMNIEEVDSSLDVILQTLIANNNKNKGAEQIITISNANSHA") # first we split this string into individual characters: v <- unlist(strsplit(MBP1, "")) # and find the positions of our charged residues ED <- grep("[ED]", v) RKH <- grep("[RKH]", v) sep <- numeric(length(ED)) # this vector will hold the distances for (i in seq_along(ED)) { sep[i] <- min(abs(RKH - ED[i])) } # Task: read and explain this bit of code # Now that sep is computed, what does it look like? table(sep) # these are the minimum distances # 24 of D,E residues are adjacent to R,K,H; # the longest separation is 28 residues. # What is the mean separation? mean(sep) # The value is 4.1 . Is this significant? Honestly, I would be hard pressed # to solve this analytically. But by permutation it's soooo easy. # First, we combine what we have done above into a function: chSep <- function(v) { # computes the mean minimum separation of oppositely charged residues # Parameter: v (char) a vector of amino acids in the one-letter code # Value: msep (numeric) mean minimum separation ED <- grep("[EDed]", v) RKH <- grep("[RKHrkh]", v) sep <- numeric(length(ED)) for (i in seq_along(ED)) { sep[i] <- min(abs(RKH - ED[i])) } return(mean(sep)) } # Execute the function to define it. # Confirm that the function gives the same result as the number we # calculated above: chSep(v) # Now we can produce a random permutation of v, and recalculate set.seed(pi) # set RNG seed for repeatable randomness w <- sample(v, length(v)) # This shuffles the vector v. Memorize this # code paradigm. It is very useful. set.seed(NULL) # reset the RNG chSep(w) # 3.273 ... that's actually less than what we had before. # Let's do this 10000 times and record the results (takes a few seconds): N <- 10000 chs <- numeric(N) for (i in 1:N) { chs[i] <- chSep(sample(v, length(v))) # charge } hist(chs) abline(v = chSep(v), col = "#EE0000") # Contrary to our expectations, the actual observed mean minimum charge # separation seems to be larger than what we observe in randomly permuted # sequences. But is this significant? Your task to find out. # = 5 Final tasks ========================================================= # From chs, compute the empirical p-value of a mean minimum charge separation to # be larger or equal to the value observed for the yeast MBP1 sequence. Note # the result in your journal. Is it significant? Also note the result of # the following expression for validation: writeBin(sum(chs), raw(8)) # [END]