Updates for BIN-ALI-BLAST
This commit is contained in:
283
scripts/ABC-makeMYSPElist.R
Normal file
283
scripts/ABC-makeMYSPElist.R
Normal file
@@ -0,0 +1,283 @@
|
||||
# ABC_makeMYSPElist.R
|
||||
#
|
||||
# Purpose: Create a list of genome sequenced fungi with protein annotations and
|
||||
# Mbp1 homologues.
|
||||
#
|
||||
# Version: 1.1.2
|
||||
#
|
||||
# Date: 2016 09 - 2017 09
|
||||
# Author: Boris Steipe (boris.steipe@utoronto.ca)
|
||||
#
|
||||
# V 1.1.2 Moved BLAST.R to ./scripts directory
|
||||
# V 1.1 Update 2017
|
||||
# V 1.0 First code 2016
|
||||
#
|
||||
# TODO:
|
||||
#
|
||||
# type out workflow
|
||||
#
|
||||
# ==============================================================================
|
||||
#
|
||||
# DO NOT source() THIS FILE!
|
||||
#
|
||||
# This file is code I provide for your deeper understanding of a process and
|
||||
# to provide you with useful sample code. It is not actually necessary for
|
||||
# you to run this code, but I encourage you to read it carefully and discuss
|
||||
# if there are parts you don't understand.
|
||||
#
|
||||
# Run the commands that interact with the NCBI servers only if you want to
|
||||
# experiment specifically with the code and/or parameters. I have commented out
|
||||
# those parts. If you only want to study the general workflow, just load()
|
||||
# the respective intermediate results.
|
||||
#
|
||||
|
||||
#TOC> ==========================================================================
|
||||
#TOC>
|
||||
#TOC> Section Title Line
|
||||
#TOC> ---------------------------------------------------
|
||||
#TOC> 1 The strategy 54
|
||||
#TOC> 2 GOLD species 66
|
||||
#TOC> 2.1 Initialize 71
|
||||
#TOC> 2.2 Import 77
|
||||
#TOC> 2.3 Unique species 129
|
||||
#TOC> 3 BLAST species 171
|
||||
#TOC> 3.1 find homologous proteins 178
|
||||
#TOC> 3.2 Identify species in "hits" 202
|
||||
#TOC> 4 Intersect GOLD and BLAST species 247
|
||||
#TOC> 5 Cleanup and finish 265
|
||||
#TOC>
|
||||
#TOC> ==========================================================================
|
||||
|
||||
|
||||
#TOC>
|
||||
#TOC>
|
||||
|
||||
# = 1 The strategy ========================================================
|
||||
|
||||
# This script will create a list of "MYSPE" species and save it in an R object
|
||||
# MYSPEspecies that is stored in the data subdirectory of this project from where
|
||||
# it can be loaded. The strategy is as follows: we download a list of all
|
||||
# genome projects and then select species for which protein annotations are
|
||||
# available - i.e. these are all genome-sequenced species that have been
|
||||
# annotated. Then we search for fungal species that have homologues to MBP1.
|
||||
# Then we intersect the two lists to give us genome-sequenced species that
|
||||
# also have Mbp1 homologues ...
|
||||
|
||||
|
||||
# = 2 GOLD species ========================================================
|
||||
|
||||
# Fetch and parse the Genomes OnLine Database of the Joint Genome Institute
|
||||
# (https://gold.jgi.doe.gov/). Use the data that is hosted at the NCBI.
|
||||
|
||||
# == 2.1 Initialize ========================================================
|
||||
if (!require(httr)) { # httr provides interfaces to Webservers on the Internet
|
||||
install.packages("httr")
|
||||
library(httr)
|
||||
}
|
||||
|
||||
# == 2.2 Import ============================================================
|
||||
|
||||
# The URL of the genome data directory at the NCBI:
|
||||
# is https://ftp.ncbi.nlm.nih.gov/genomes/GENOME_REPORTS
|
||||
# Note the relative size of the prokaryotes and the eukaryotes data.
|
||||
|
||||
# What's in this directory?
|
||||
URL <- "ftp://ftp.ncbi.nlm.nih.gov/genomes/GENOME_REPORTS/README"
|
||||
GOLDreadme <- readLines(URL) # read the file into a vector
|
||||
cat(GOLDreadme, sep = "\n") # display the contents
|
||||
|
||||
# Retrieve the file "eukaryotes" via ftp from the NCBI ftp server and put it
|
||||
# into a dataframe. This will take a few moments.
|
||||
# URL <- "ftp://ftp.ncbi.nlm.nih.gov/genomes/GENOME_REPORTS/eukaryotes.txt"
|
||||
# GOLDdata <- read.csv(URL,
|
||||
# header = TRUE,
|
||||
# sep = "\t",
|
||||
# stringsAsFactors = FALSE)
|
||||
# save(GOLDdata, file="data/GOLDdata.RData")
|
||||
# or ...
|
||||
load(file="data/GOLDdata.RData")
|
||||
|
||||
|
||||
# What columns does the table have, how is it structured?
|
||||
str(GOLDdata)
|
||||
|
||||
# What groups of organisms are in the table? How many of each?
|
||||
table(GOLDdata$Group)
|
||||
|
||||
# What subgroups of fungi do we have?
|
||||
table(GOLDdata$SubGroup[GOLDdata$Group == "Fungi"])
|
||||
|
||||
# How many of the fungi have protein annotations? The README file told us that
|
||||
# the column "Proteins" contains "Number of Proteins annotated in the assembly".
|
||||
# Looking at a few ...
|
||||
head(GOLDdata$Proteins, 30)
|
||||
# ... we see that the number varies, and some have a hyphen, i.e. no
|
||||
# annotations. The hyphens make this a char type column (as per: all elements
|
||||
# of a vector must have the same type). Therefore we can't read this as numbers
|
||||
# and filter by some value > 0. But we can filter for all genomes that don't
|
||||
# have the hyphen:
|
||||
sum(GOLDdata$Proteins[GOLDdata$Group == "Fungi"] != "-")
|
||||
|
||||
# Subset the data, with fungi that have protein annotations
|
||||
GOLDfungi <- GOLDdata[GOLDdata$Group == "Fungi" &
|
||||
GOLDdata$Proteins != "-" , ]
|
||||
|
||||
# check what we have in the table
|
||||
nrow(GOLDfungi)
|
||||
head(GOLDfungi)
|
||||
|
||||
|
||||
# == 2.3 Unique species ====================================================
|
||||
|
||||
# For our purpose of defining species, we will select only species, not strains
|
||||
# from this list. To do this, we pick the first two words i.e. the systematic
|
||||
# binomial name from the "X.Organism.Name" column, and then we remove redundant
|
||||
# species. Here is a function:
|
||||
#
|
||||
|
||||
getBinom <- function(s) {
|
||||
# Fetch the first two words from a string.
|
||||
# Parameters:
|
||||
# s: char a string which is expected to contain a binomial species name
|
||||
# as the first two words, possibly followed by other text.
|
||||
# Value: char the first two words separated by a single blank
|
||||
#
|
||||
x <- unlist(strsplit(s, "\\s+")) # split s on one or more whitespace
|
||||
return(paste(x[1:2], collapse=" ")) # return first two elements
|
||||
}
|
||||
|
||||
# iterate through GOLDdata and extract species names
|
||||
GOLDspecies <- character()
|
||||
for (i in 1:nrow(GOLDfungi)) {
|
||||
GOLDspecies[i] <- getBinom(GOLDfungi$X.Organism.Name[i])
|
||||
}
|
||||
head(GOLDspecies)
|
||||
length(GOLDspecies)
|
||||
|
||||
# N.b. this would be more efficiently (but perhaps less explicitly) coded with
|
||||
# one of the apply() functions, instead of a for-loop.
|
||||
# GOLDspecies <- unlist(lapply(GOLDfungi$X.Organism.Name, getBinom))
|
||||
|
||||
# Species of great interest may appear more than once, one for each sequenced
|
||||
# strain: e.g. brewer's yeast:
|
||||
sum(GOLDspecies == "Saccharomyces cerevisiae")
|
||||
|
||||
# Therefore we use the function unique() to throw out duplicates. Simple:
|
||||
GOLDspecies <- unique(GOLDspecies)
|
||||
|
||||
length(GOLDspecies)
|
||||
# i.e. we got rid of about 40% of the species by removing duplicates.
|
||||
|
||||
|
||||
# = 3 BLAST species =======================================================
|
||||
#
|
||||
# Next, we filter our list by species that have homologues to the yeast Mbp1
|
||||
# gene. To do this we run a BLAST search to find all related proteins in any
|
||||
# fungus. We list the species that appear in that list, and then we select those
|
||||
# that appear in our GOLD table as well.
|
||||
#
|
||||
# == 3.1 find homologous proteins ==========================================
|
||||
#
|
||||
# Use BLAST to fetch proteins related to Mbp1 and identify the species that
|
||||
# contain them.
|
||||
|
||||
# Scripting against NCBI APIs is not exactly enjoyable - there is usually a fair
|
||||
# amount of error handling involved that is not supported by the API in a
|
||||
# principled way but requires rather ad hoc solutions. The code I threw together
|
||||
# to make a BLAST interface (demo-quality, not research-quality) is in the file
|
||||
# ./scripts/BLAST.R Feel encouraged to study how this works. It's a pretty
|
||||
# standard task of communicating with servers and parsing responses - everyday
|
||||
# fare in thebioinformatics lab. Surprisingly, there seems to be no good BLAST
|
||||
# parser in currently available packages.
|
||||
|
||||
# source("./scripts/BLAST.R") # load the function and its utilities
|
||||
# Use BLAST() to find yeast Mbp1 homologues in other fungi in refseq
|
||||
# BLASThits <- BLAST("NP_010227", # Yeast Mbp1 RefSeq ID
|
||||
# db = "refseq_protein", # database to search in
|
||||
# nHits = 3000, # 720 hits in 2017
|
||||
# E = 0.01, #
|
||||
# limits = "txid4751[ORGN]") # = fungi
|
||||
# save(BLASThits, file="data/BLASThits.RData")
|
||||
load(file="data/BLASThits.RData")
|
||||
|
||||
# == 3.2 Identify species in "hits" ========================================
|
||||
|
||||
# This is a very big list that can't be usefully analyzed manually. Here
|
||||
# we are only interested in the species names that it contains.
|
||||
|
||||
# How many hits in the list?
|
||||
length(BLASThits$hits)
|
||||
|
||||
# Let's look at a hit somewhere down the list
|
||||
str(BLASThits$hit[[277]])
|
||||
|
||||
# A fair amount of parsing has gone into the BLAST.R code to prepare the results
|
||||
# in a useful way. The species information is in the $species element of every
|
||||
# hit.
|
||||
|
||||
# Run a loop to extract all the species names into a vector. We subset ...
|
||||
# Blasthits$hits ... the list of hits, from which we choose ...
|
||||
# Blasthits$hits[[i]] ... the i-th hit, and get ...
|
||||
# Blasthits$hits[[i]]$species ... the species element from that.
|
||||
# Subsetting FTW.
|
||||
|
||||
BLASTspecies <- character()
|
||||
for (i in seq_along(BLASThits$hits)) {
|
||||
BLASTspecies[i] <-BLASThits$hits[[i]]$species
|
||||
}
|
||||
|
||||
# You can confirm that BLASTspecies has the expected size.
|
||||
length(BLASTspecies)
|
||||
|
||||
# Again, some species appear more than once, e.g. ...
|
||||
sum(BLASTspecies == "Saccharomyces cerevisiae")
|
||||
|
||||
# ... corresponding to the five homologous gene sequences (paralogues) of yeast.
|
||||
|
||||
# Therefore we use unique() to throw out duplicates:
|
||||
BLASTspecies <- unique(BLASTspecies)
|
||||
|
||||
length(BLASTspecies)
|
||||
# i.e. we got rid of about two thirds of the hits.
|
||||
|
||||
# You should think about this: what is the biological interpretation of the
|
||||
# finding that on average we have three sequences that are similar to Mbp1 in
|
||||
# other species?
|
||||
|
||||
|
||||
# = 4 Intersect GOLD and BLAST species ====================================
|
||||
|
||||
# Now we can compare the two lists for species that appear in both sources: the
|
||||
# simplest way is to use the set operation functions union(), intersection()
|
||||
# etc. See here:
|
||||
?union
|
||||
|
||||
MYSPEspecies <- intersect(GOLDspecies, BLASTspecies)
|
||||
|
||||
# Again: interpret this:
|
||||
# - what is the number of GOLDspecies?
|
||||
# - what is the number of BLAST species?
|
||||
# - how many species are present in both lists?
|
||||
# - what does it mean if a species is in GOLD but not in the BLAST list?
|
||||
# - what does it mean if a species has been found during BLAST, but it
|
||||
# is not in GOLD?
|
||||
|
||||
|
||||
# = 5 Cleanup and finish ==================================================
|
||||
|
||||
# One final thing: some of the species will be our so-called "reference" species
|
||||
# which we use for model solutions and examples in the course. They are defined
|
||||
# in the .utilities.R file of this project. We remove them from the list so that
|
||||
# we don't inadvertently assign them.
|
||||
#
|
||||
|
||||
REFspecies
|
||||
|
||||
MYSPEspecies <- sort(setdiff(MYSPEspecies, REFspecies))
|
||||
|
||||
# save(MYSPEspecies, file = "data/MYSPEspecies.RData")
|
||||
|
||||
|
||||
|
||||
|
||||
# [END]
|
||||
348
scripts/BLAST.R
Normal file
348
scripts/BLAST.R
Normal file
@@ -0,0 +1,348 @@
|
||||
# BLAST.R
|
||||
#
|
||||
# Purpose: Send off one BLAST search and return parsed list of results
|
||||
# This script uses the BLAST URL-API
|
||||
# (Application Programming Interface) at the NCBI.
|
||||
# Read about the constraints here:
|
||||
# https://ncbi.github.io/blast-cloud/dev/api.html
|
||||
#
|
||||
#
|
||||
# Version: 2.1
|
||||
# Date: 2016 09 - 2017 10
|
||||
# Author: Boris Steipe
|
||||
#
|
||||
# Versions:
|
||||
# 2.1 bugfix in BLAST(), bug was blanking non-split deflines;
|
||||
# refactored parseBLASTalignment() to handle lists with multiple hits.
|
||||
# 2.0 Completely rewritten because the interface completely changed.
|
||||
# Code adpated in part from NCBI Perl sample code:
|
||||
# $Id: web_blast.pl,v 1.10 2016/07/13 14:32:50 merezhuk Exp $
|
||||
#
|
||||
# 1.0 first version posted for BCH441 2016, based on BLAST - API
|
||||
#
|
||||
# ToDo:
|
||||
#
|
||||
# Notes: This is somewhat pedestrian, but apparently there are currently
|
||||
# no R packages that contain such code.
|
||||
#
|
||||
# ==============================================================================
|
||||
|
||||
|
||||
if (!require(httr, quietly = TRUE)) {
|
||||
install.packages("httr")
|
||||
library(httr)
|
||||
}
|
||||
|
||||
|
||||
BLAST <- function(q,
|
||||
db = "refseq_protein",
|
||||
nHits = 30,
|
||||
E = 0.1,
|
||||
limits = "",
|
||||
rid = "",
|
||||
quietly = FALSE,
|
||||
myTimeout = 120) {
|
||||
# Purpose:
|
||||
# Basic BLAST search
|
||||
# Version: 2.0
|
||||
# Date: 2017-09
|
||||
# Author: Boris Steipe
|
||||
#
|
||||
# Parameters:
|
||||
# q: query - either a valid ID or a sequence
|
||||
# db: "refseq_protein" by default,
|
||||
# other legal valuses include: "nr", "pdb", "swissprot" ...
|
||||
# nHits: number of hits to maximally return
|
||||
# E: E-value cutoff. Do not return hits whose score would be expected
|
||||
# to occur E or more times in a database of random sequence.
|
||||
# limits: a valid ENTREZ filter
|
||||
# rid: a request ID - to retrieve earleir search results
|
||||
# quietly: controls printing of wait-time progress bar
|
||||
# timeout: how much longer _after_ rtoe to wait for a result
|
||||
# before giving up (seconds)
|
||||
# Value:
|
||||
# result: list of resulting hits and some metadata
|
||||
|
||||
|
||||
EXTRAWAIT <- 10 # duration of extra wait cycles if BLAST search is not done
|
||||
|
||||
results <- list()
|
||||
results$rid <- rid
|
||||
results$rtoe <- 0
|
||||
|
||||
if (rid == "") { # if rid is not the empty string we skip the
|
||||
# initial search and and proceed directly to retrieval
|
||||
|
||||
|
||||
# prepare query, GET(), and parse rid and rtoe from BLAST server response
|
||||
results$query <- paste0("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
||||
"?",
|
||||
"CMD=Put",
|
||||
"&PROGRAM=", "blastp",
|
||||
"&QUERY=", URLencode(q),
|
||||
"&DATABASE=", db,
|
||||
"&MATRIX=", "BLOSUM62",
|
||||
"&EXPECT=", as.character(E),
|
||||
"&HITLIST_SIZE=", as.character(nHits),
|
||||
"&ALIGNMENTS=", as.character(nHits),
|
||||
"&FORMAT_TYPE=Text")
|
||||
|
||||
if (limits != "") {
|
||||
results$query <- paste0(
|
||||
results$query,
|
||||
"&ENTREZ_QUERY=", limits)
|
||||
}
|
||||
|
||||
# send it off ...
|
||||
response <- GET(results$query)
|
||||
if (http_status(response)$category != "Success" ) {
|
||||
stop(sprintf("PANIC: Can't send query. BLAST server status error: %s",
|
||||
http_status(response)$message))
|
||||
}
|
||||
|
||||
txt <- content(response, "text", encoding = "UTF-8")
|
||||
|
||||
patt <- "RID = (\\w+)" # match the request id
|
||||
results$rid <- regmatches(txt, regexec(patt, txt))[[1]][2]
|
||||
|
||||
patt <- "RTOE = (\\d+)" # match the expected completion time
|
||||
results$rtoe <- as.numeric(regmatches(txt, regexec(patt, txt))[[1]][2])
|
||||
|
||||
# Now we wait ...
|
||||
if (quietly) {
|
||||
Sys.sleep(results$rtoe)
|
||||
} else {
|
||||
cat(sprintf("BLAST is processing %s:\n", results$rid))
|
||||
waitTimer(results$rtoe)
|
||||
}
|
||||
|
||||
} # done sending query and retrieving rid, rtoe
|
||||
|
||||
# Enter an infinite loop to check for result availability
|
||||
checkStatus <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
||||
"?",
|
||||
"CMD=Get",
|
||||
"&RID=", results$rid,
|
||||
"&FORMAT_TYPE=Text",
|
||||
"&FORMAT_OBJECT=SearchInfo",
|
||||
sep = "")
|
||||
|
||||
while (TRUE) {
|
||||
# Check whether the result is ready
|
||||
response <- GET(checkStatus)
|
||||
if (http_status(response)$category != "Success" ) {
|
||||
stop(sprintf("PANIC: Can't check status. BLAST server status error: %s",
|
||||
http_status(response)$message))
|
||||
}
|
||||
|
||||
txt <- content(response, "text", encoding = "UTF-8")
|
||||
|
||||
if (length(grep("Status=WAITING", txt)) > 0) {
|
||||
myTimeout <- myTimeout - EXTRAWAIT
|
||||
|
||||
if (myTimeout <= 0) { # abort
|
||||
cat("BLAST search not concluded before timeout. Aborting.\n")
|
||||
cat(sprintf("You could check back later with rid \"%s\"\n",
|
||||
results$rid))
|
||||
return(results)
|
||||
}
|
||||
|
||||
if (quietly) {
|
||||
Sys.sleep(EXTRAWAIT)
|
||||
} else {
|
||||
cat(sprintf("Status: Waiting. Wait %d more seconds (max. %d more)",
|
||||
EXTRAWAIT,
|
||||
myTimeout))
|
||||
waitTimer(EXTRAWAIT)
|
||||
next
|
||||
}
|
||||
|
||||
} else if (length(grep("Status=FAILED", txt)) > 0) {
|
||||
cat("BLAST search returned status \"FAILED\". Aborting.\n")
|
||||
return(results)
|
||||
|
||||
} else if (length(grep("Status=UNKNOWN", txt)) > 0) {
|
||||
cat("BLAST search returned status \"UNKNOWN\".\n")
|
||||
cat("This probably means the rid has expired. Aborting.\n")
|
||||
return(results)
|
||||
|
||||
} else if (length(grep("Status=READY", txt)) > 0) { # Done
|
||||
|
||||
if (length(grep("ThereAreHits=yes", txt)) == 0) { # No hits
|
||||
cat("BLAST search ready but no hits found. Aborting.\n")
|
||||
return(results)
|
||||
|
||||
} else {
|
||||
break # done ... retrieve search result
|
||||
}
|
||||
}
|
||||
} # end result-check loop
|
||||
|
||||
# retrieve results from BLAST server
|
||||
retrieve <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
||||
"?",
|
||||
"&CMD=Get",
|
||||
"&RID=", results$rid,
|
||||
"&FORMAT_TYPE=Text",
|
||||
sep = "")
|
||||
|
||||
response <- GET(retrieve)
|
||||
if (http_status(response)$category != "Success" ) {
|
||||
stop(sprintf("PANIC: Can't retrieve. BLAST server status error: %s",
|
||||
http_status(response)$message))
|
||||
}
|
||||
|
||||
txt <- content(response, "text", encoding = "UTF-8")
|
||||
|
||||
# txt contains the whole set of results. Process:
|
||||
|
||||
# First, we strsplit() on linebreaks:
|
||||
txt <- unlist(strsplit(txt, "\n"))
|
||||
|
||||
# The alignments range from the first line that begins with ">" ...
|
||||
iFirst <- grep("^>", txt)[1]
|
||||
|
||||
# ... to the last line that begins with "Sbjct"
|
||||
x <- grep("^Sbjct", txt)
|
||||
iLast <- x[length(x)]
|
||||
|
||||
# Get the alignments block
|
||||
txt <- txt[iFirst:iLast]
|
||||
|
||||
# Drop empty lines
|
||||
txt <- txt[!(nchar(txt) == 0)]
|
||||
|
||||
# A line that ends "]" but does not begin ">" seems to be a split
|
||||
# defline ... eg.
|
||||
# [1] ">XP_013349208.1 AUEXF2481DRAFT_695809 [Aureobasidium subglaciale "
|
||||
# [2] "EXF-2481]"
|
||||
# Merge these lines to the preceding lines and delete them.
|
||||
#
|
||||
x <- which(grepl("]$", txt) & !(grepl("^>", txt)))
|
||||
if (length(x) > 0) {
|
||||
txt[x-1] <- paste0(txt[x-1], txt[x])
|
||||
txt <- txt[-x]
|
||||
}
|
||||
|
||||
# Special case: there may be multiple deflines when the BLAST hit is to
|
||||
# redundant, identical sequences. Keep only the first instance.
|
||||
iKeep <- ! grepl("^>", txt)
|
||||
x <- rle(iKeep)
|
||||
x$positions <- cumsum(x$lengths)
|
||||
i <- which(x$lengths > 1 & x$values == FALSE)
|
||||
if (length(i) > 0) {
|
||||
firsts <- x$positions[i] - x$lengths[i] + 1
|
||||
iKeep[firsts] <- TRUE
|
||||
txt <- txt[iKeep]
|
||||
}
|
||||
|
||||
# After this preprocessing the following should be true:
|
||||
# - Every alignment block begins with a defline in which the
|
||||
# first character is ">"
|
||||
# - There is only one defline in each block.
|
||||
# - Lines are not split.
|
||||
|
||||
# Make a dataframe of first and last indices of alignment blocks
|
||||
x <- grep("^>", txt)
|
||||
blocks <- data.frame(iFirst = x,
|
||||
iLast = c((x[-1] - 1), length(txt)))
|
||||
|
||||
# Build the hits list by parsing the blocks
|
||||
results$hits <- list()
|
||||
|
||||
for (i in seq_len(nrow(blocks))) {
|
||||
thisBlock <- txt[blocks$iFirst[i]:blocks$iLast[i]]
|
||||
results$hits[[i]] <- parseBLASTalignment(thisBlock)
|
||||
}
|
||||
|
||||
return(results)
|
||||
}
|
||||
|
||||
parseBLASTalignment <- function(hits, idx) {
|
||||
# Parse one BLAST hit from a BLAST result
|
||||
# Parameters:
|
||||
# hits list contains the BLAST hits
|
||||
# idx int index of the requested hit
|
||||
# Value:
|
||||
# list $def chr defline
|
||||
# $accession chr accession number
|
||||
# $organism chr complete organism definition
|
||||
# $species chr binomial species
|
||||
# $E num E value
|
||||
# $lengthAli num length of the alignment
|
||||
# $nIdentitites num number of identities
|
||||
# $nGaps num number of gaps
|
||||
# $Qbounds num 2-element vector of query start-end
|
||||
# $Sbounds num 2-element vector of subject start-end
|
||||
# $Qseq chr query sequence
|
||||
# $midSeq chr midline string
|
||||
# $Sseq chr subject sequence
|
||||
|
||||
h <- list()
|
||||
|
||||
hit <- hits$hits[[idx]]
|
||||
|
||||
# FASTA defline
|
||||
h$def <- hit$def
|
||||
|
||||
# accesion number (ID), use the first if there are several, separated by "|"
|
||||
patt <- "^>(.+?)(\\s|\\|)" # from ">" to space or "|"
|
||||
h$accession <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
|
||||
|
||||
# organism
|
||||
patt <- "\\[(.+)]"
|
||||
h$organism <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
|
||||
|
||||
# species
|
||||
x <- unlist(strsplit(h$organism, "\\s+"))
|
||||
if (length(x) >= 2) {
|
||||
h$species <- paste(x[1], x[2])
|
||||
} else if (length(x) == 1) {
|
||||
h$species <- paste(x[1], "sp.")
|
||||
} else {
|
||||
h$species <- NA
|
||||
}
|
||||
|
||||
# E-value
|
||||
h$E <- hit$E
|
||||
|
||||
# length of hit and # identities
|
||||
h$lengthAli <- hit$lengthAli
|
||||
h$nIdentities <- hit$nIdentities
|
||||
|
||||
# number of gaps
|
||||
h$nGaps <- hit$nGaps
|
||||
|
||||
# first and last positions
|
||||
h$Qbounds <- hit$Qbounds
|
||||
h$Sbounds <- hit$Sbounds
|
||||
|
||||
# aligned sequences
|
||||
|
||||
h$Qseq <- hit$Qseq
|
||||
h$midSeq <- hit$midSeq
|
||||
h$Sseq <- hit$Sseq
|
||||
|
||||
return(h)
|
||||
}
|
||||
|
||||
|
||||
# ==== TESTS ===================================================================
|
||||
|
||||
# define query:
|
||||
# q <- paste("IYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHI", # Mbp1 APSES domain sequence
|
||||
# "LKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQ",
|
||||
# "GTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASP",
|
||||
# sep="")
|
||||
# or ...
|
||||
# q <- "NP_010227" # refseq ID
|
||||
#
|
||||
# test <- BLAST(q,
|
||||
# nHits = 100,
|
||||
# E = 0.001,
|
||||
# rid = "",
|
||||
# limits = "txid4751[ORGN]")
|
||||
# length(test$hits)
|
||||
|
||||
# [END]
|
||||
|
||||
Reference in New Issue
Block a user