My current work.

myScripts/.myProfile.R

@@ -0,0 +1,21 @@
+# .myProfile.R
+# This contains information which the course framework needs from time to time
+# to personalize assignments, validate submissions etc. Make sure that
+# the information correctly matches our official records.
+# myEmail          char      A string with your eMail address. Use your official
+#                            UofT eMail address.
+# myStudentNumber  numeric   Your UofT student number. Take care to have this
+#                            correct.
+#
+# NOTE:
+# After you have updated this script, move the file to your "myScripts" folder.
+# Utility scripts will look for it on the path: "./myScripts/.myProfile.R"
+#
+# ==============================================================================
+# options(stringsAsFactors = FALSE)
+
+myEMail <- "yh.deng@mail.utoronto.ca"        # e.g. "u.franklin@utoronto.ca"
+myStudentNumber <- 1005845285  # e.g. 1003141592
+MYSPE <- "Cutaneotrichosporon oleaginosum" 
+
+# [END]

myScripts/CUTOLTaxonomy.json

@@ -0,0 +1,4 @@
+[{
+	"ID": 879819,
+	"species": "Cutaneotrichosporon oleaginosum"}
+]

myScripts/MBP1_CUTOL.json

@@ -0,0 +1,19 @@
+[
+  { "name" : "MBP1_CUTOL",
+    "RefSeqID" : "XP_018278493.1",
+    "UniProtID" : "A0A0J0XLN0",
+    "taxonomyID" : 879819,
+    "sequence" : [
+       "MGKKAAAAGDGGPNTIYKATYSGVPVFEFICRNVAVMRRRSDAYLNATQILKVAGFDKPQRTRVLEREVQ",
+       "KGEHEKVQGGYGKYQGTWVPIERGLALAKQYNVEDLLRPIIDFVPRESVSPPPAPKHAVAPPTKRNKEPK",
+       "PKEGLVPIKSAGVLSGTGRHQTPDSVGEDVESEVMDDMSESQTPSPLNGTSLLPAVDERSIDGMDIDGFS",
+       "MMNGGGHARKRSAAMMDDEDEYEQLKRARGNSAVHTPPPPGQSPRYGGMQHPLTQDEYNDIVLNYFVSEA",
+       "TQIPAVMTNPPYNWDPNGIIDDDHHTALHWAAAMGRTRVIKLLLSAGARIFDKNNLDQTPLMRSVMFTNN",
+       "YDLRKFPEVFELLHRSTLNIDKNNRTVFHHIANLALYKGKTHAARYYMEVILSRLADYPQELADVINFAD",
+       "EDGETALTLAARARSKRIVKALLDHGADPKLRNRDHKSAEDYILEDERFRSSPDVMLNRTQPSAAPRNPT",
+       "SLGAAVFSQGLPPQLYNSEAARLASGPHSSDILQQMQALARSFEAEKLNKERDVLEAKAMLTSIHTEVND",
+       "AGRTLHNLGEQMKPLEAKQGELDGLVERLQSKLQKDLARGARKWKAADEGRENRWKNGDDPSQAGEDYSD",
+       "LPELTAIPDNAEAEEERLRGEIEKMRARRGELVTRLVKAQTQTGTTDKMAQYRRLITAGCGGDINPGEID",
+       "DIVGQLLDMLENEAQSGRPAPPPQAAPSWVTS"]
+  }
+]

myScripts/makeProteinDB.R

@@ -0,0 +1,4 @@
+source("./scripts/ABC-createRefDB.R")
+
+myDB <- dbAddProtein(myDB, jsonlite::fromJSON("./myScripts/MBP1_CUTOL.json"))
+myDB <- dbAddTaxonomy(myDB, jsonlite::fromJSON("./myScripts/CUTOLtaxonomy.json"))

myScripts/myScript.R

@@ -0,0 +1,38 @@
+# myScript.R
+#
+# --- As you work with this file, you can delete the instructions below --------
+# Write your notes and code experiments into this document. Save it
+# from time to time - however I recommend that you do not _commit_
+# your saved version.
+#
+# As long as you do not _commit_ this script to version control,
+# you can _pull_ updated versions of the entire project from GitHub
+# by using the RStudio version control interface. However, once
+# you _commit_ any file in your local version, RStudio will require
+# you to resolve conflicts before you can _pull_ updates.
+# --- As you work with this file, you can delete the instructions above --------
+#
+## Purpose: <...>
+#
+# Version: <...>
+#
+# Date:    <...>
+# Author:  <Name> (<namee@mail.utoronto.ca>)
+#
+# Versions:
+#
+#   <number>    <Features>
+#
+# TODO:
+#   <...>
+#
+# ====================================================================
+
+
+
+
+
+
+
+# [END]
+