New unit and associated FASTA files
This commit is contained in:
@@ -3,67 +3,267 @@
|
||||
# Purpose: A Bioinformatics Course:
|
||||
# R code accompanying the BIN-ALI-Similarity unit.
|
||||
#
|
||||
# Version: 0.1
|
||||
# Version: 1.0
|
||||
#
|
||||
# Date: 2017 08 28
|
||||
# Date: 2017 10 20
|
||||
# Author: Boris Steipe (boris.steipe@utoronto.ca)
|
||||
#
|
||||
# Versions:
|
||||
# 1.0 Refactored for 2017; add aaindex, ternary plot.
|
||||
# 0.1 First code copied from 2016 material.
|
||||
|
||||
#
|
||||
#
|
||||
# TODO:
|
||||
#
|
||||
#
|
||||
# == DO NOT SIMPLY source() THIS FILE! =======================================
|
||||
|
||||
#
|
||||
# If there are portions you don't understand, use R's help system, Google for an
|
||||
# answer, or ask your instructor. Don't continue if you don't understand what's
|
||||
# going on. That's not how it works ...
|
||||
|
||||
#
|
||||
# ==============================================================================
|
||||
|
||||
# = 1 Mutation Data matrix
|
||||
#TOC> ==========================================================================
|
||||
#TOC>
|
||||
#TOC> Section Title Line
|
||||
#TOC> ----------------------------------------
|
||||
#TOC> 1 Amino Acid Properties 40
|
||||
#TOC> 2 Mutation Data matrix 150
|
||||
#TOC> 3 Background score 188
|
||||
#TOC>
|
||||
#TOC> ==========================================================================
|
||||
|
||||
|
||||
|
||||
|
||||
# = 1 Amino Acid Properties ===============================================
|
||||
|
||||
# A large collection of amino acid property tables is available via the seqinr
|
||||
# package:
|
||||
|
||||
if (!require(seqinr)) {
|
||||
install.packages("seqinr")
|
||||
library(seqinr)
|
||||
}
|
||||
|
||||
# A true Labor of Love has gone into the compilation of the seqinr "aaindex"
|
||||
# data:
|
||||
|
||||
?aaindex
|
||||
data(aaindex) # load the aaindex list from the package
|
||||
|
||||
length(aaindex)
|
||||
|
||||
# Here are all the index descriptions
|
||||
for (i in 1:length(aaindex)) {
|
||||
cat(paste(i, ": ", aaindex[[i]]$D, "\n", sep=""))
|
||||
}
|
||||
|
||||
# It's a bit cumbersome to search through the descriptions ... here is a
|
||||
# function to make this easier:
|
||||
|
||||
searchAAindex <- function(patt) {
|
||||
# Searches the aaindex descriptions for regular expression "patt"
|
||||
# and prints index number and description.
|
||||
hits <- which(sapply(aaindex, function(x) length(grep(patt, x$D)) > 0))
|
||||
for (i in seq_along(hits)) {
|
||||
cat(sprintf("%3d\t%s\n", hits[i], aaindex[[ hits[i] ]]$D))
|
||||
}
|
||||
}
|
||||
|
||||
|
||||
searchAAindex("free energy") # Search for "free energy"
|
||||
searchAAindex("(size)|(volume)") # Search for "size" or "volume":
|
||||
|
||||
|
||||
|
||||
|
||||
# Let's examine ...
|
||||
# ... a hydrophobicity index
|
||||
(Y <- aaindex[[528]][c("D", "I")])
|
||||
|
||||
# ... a volume index
|
||||
(V <- aaindex[[150]][c("D", "I")])
|
||||
|
||||
# ... and one of our own: side-chain pK values as reported by
|
||||
# Pace et al. (2009) JBC 284:13285-13289, with non-ionizable pKs set
|
||||
# to 7.4 (physiological pH)
|
||||
K <- list(I = c( 7.4, # Ala
|
||||
12.3, # Arg
|
||||
7.4, # Asn
|
||||
3.9, # Asp
|
||||
8.6, # Cys
|
||||
7.4, # Gln
|
||||
4.3, # Glu
|
||||
7.4, # Gly
|
||||
6.5, # His
|
||||
7.4, # Ile
|
||||
7.4, # Leu
|
||||
10.4, # Lys
|
||||
7.4, # Met
|
||||
7.4, # Phe
|
||||
7.4, # Pro
|
||||
7.4, # Ser
|
||||
7.4, # Thr
|
||||
7.4, # Trp
|
||||
9.8, # Tyr
|
||||
7.4)) # Val
|
||||
names(K$I) <- c("Ala","Arg","Asn","Asp","Cys","Gln","Glu","Gly","His","Ile",
|
||||
"Leu","Lys","Met","Phe","Pro","Ser","Thr","Trp","Tyr","Val")
|
||||
|
||||
|
||||
# Given these biophysical indices, how similar are the amino acids? We have three-dimensions of measures here. Scatterplots can only display two dimensions ...
|
||||
plot(Y$I, V$I, col="white", xlab = "hydrophobicity", ylab = "volume")
|
||||
text(Y$I, V$I, names(Y$I))
|
||||
|
||||
plot(Y$I, K$I, col="white", xlab = "hydrophobicity", ylab = "pK")
|
||||
text(Y$I, K$I, names(Y$I))
|
||||
|
||||
# ... but how do we plot 3D data? Plotting into a 3D cube is possible, but such
|
||||
# plots are in general unintuitive and hard to interpret. One alternative is a
|
||||
# so-called "ternary plot":
|
||||
|
||||
if (!require(ggtern)) {
|
||||
install.packages("ggtern")
|
||||
library(ggtern)
|
||||
}
|
||||
|
||||
# collect into data frame, normalize to (0.05, 0.95)
|
||||
myDat <- data.frame("phi" = 0.9*(((Y$I-min(Y$I))/(max(Y$I)-min(Y$I))))+0.05,
|
||||
"vol" = 0.9*(((V$I-min(V$I))/(max(V$I)-min(V$I))))+0.05,
|
||||
"pK" = 0.9*(((K$I-min(K$I))/(max(K$I)-min(K$I))))+0.05,
|
||||
stringsAsFactors = FALSE)
|
||||
rownames(myDat) <- names(Y$I)
|
||||
|
||||
ggtern(data = myDat,
|
||||
aes(x = vol,
|
||||
y = phi,
|
||||
z = pK,
|
||||
label = rownames(myDat))) +
|
||||
geom_text()
|
||||
|
||||
# This results in a mapping of amino acids relative to each other that is
|
||||
# similar to the Venn diagram you have seen in the notes.
|
||||
|
||||
|
||||
# = 2 Mutation Data matrix ================================================
|
||||
|
||||
# A mutation data matrix encodes all amino acid pairscores in a matrix.
|
||||
|
||||
# The Biostrings package contains the most common mutation data matrices.
|
||||
|
||||
# First, we install and load the Biostrings package.
|
||||
if (!require(Biostrings, quietly=TRUE)) {
|
||||
source("https://bioconductor.org/biocLite.R")
|
||||
biocLite("Biostrings")
|
||||
library(Biostrings)
|
||||
}
|
||||
|
||||
|
||||
# Biostrings contains mutation matrices and other useful datasets
|
||||
data(package = "Biostrings")
|
||||
|
||||
# Let's load BLOSUM62
|
||||
# Let's load the BLOSUM62 mutation data matrix from the package
|
||||
data(BLOSUM62)
|
||||
|
||||
# ... and see what it contains. (You've seen this before, right?)
|
||||
# ... and see what it contains. (You've seen this matrix before.)
|
||||
BLOSUM62
|
||||
|
||||
# We can simply access values via the row/column names to look at the data
|
||||
# for the questions I asked in the Assignment on the Wiki:
|
||||
BLOSUM62["H", "H"]
|
||||
BLOSUM62["S", "S"]
|
||||
# We can simply access values via the row/column names.
|
||||
# Identical amino acids have high scores ...
|
||||
BLOSUM62["H", "H"] # Score for a pair of two histidines
|
||||
BLOSUM62["S", "S"] # Score for a pair of two serines
|
||||
|
||||
BLOSUM62["L", "K"]
|
||||
BLOSUM62["L", "I"]
|
||||
# Similar amino acids have low positive scores ...
|
||||
BLOSUM62["L", "I"] # Score for a leucine / lysine pair
|
||||
BLOSUM62["F", "Y"] # etc.
|
||||
|
||||
# Dissimilar amino acids have negative scores ...
|
||||
BLOSUM62["L", "K"] # Score for a leucine / lysine pair
|
||||
BLOSUM62["Q", "P"] # etc.
|
||||
|
||||
|
||||
BLOSUM62["R", "W"]
|
||||
BLOSUM62["W", "R"] # the matrix is symmetric!
|
||||
BLOSUM62["R", "W"] # the matrix is symmetric!
|
||||
BLOSUM62["W", "R"]
|
||||
|
||||
|
||||
# = 3 Background score ====================================================
|
||||
|
||||
# The mutation data matrix is designed to give high scores to homologous sequences, low scores to non-homologous sequences. What score on average should we expect for a random sequence?
|
||||
|
||||
# = 1.1 <<<Subsection>>>
|
||||
# If we sample amino acid pairs at random, we will get a score that is the
|
||||
# average of the individual pairscores in the matrix. Omitting the ambiguity
|
||||
# codes and the gap character:
|
||||
|
||||
sum(BLOSUM62[1:20, 1:20])/400
|
||||
|
||||
# But that score could be higher for real sequences, for which the amino acid
|
||||
# distribution is not random. For example membrane proteins have a large number
|
||||
# of hydrophobic residues - an alignment of unrelated proteins might produce
|
||||
# positive scores. And there are other proteins with biased amino acid
|
||||
# compositions, in particular poteins that interact with multiple other
|
||||
# proteins. Let's test how this impacts the background score by comparing a
|
||||
# sequence with shuffled sequences. These have the same composition, but are
|
||||
# obvioulsy not homologous. The data directory contains the FASTA file for the
|
||||
# PDB ID 3FG7 - a villin headpiece structure with a large amount of
|
||||
# low-complexity amino acid sequence ...
|
||||
|
||||
# = 1 Tasks
|
||||
aa3FG7 <- readAAStringSet("./data/3FG7.fa")[[1]]
|
||||
|
||||
# ... and the FASTA file for the E. coli OmpG outer membrane porin (PDB: 2F1C)
|
||||
# with an exceptionally high percentage of hydrophobic residues.
|
||||
|
||||
aa2F1C <- readAAStringSet("./data/2F1C.fa")[[1]]
|
||||
|
||||
# Here is a function that takes two sequences and
|
||||
# returns their average pairscore.
|
||||
|
||||
averagePairScore <- function(a, b, MDM = BLOSUM62) {
|
||||
# Returns average pairscore of two sequences.
|
||||
# Parameters:
|
||||
# a, b chr amino acid sequence string
|
||||
# MDM mutation data matrix. Default is BLOSUM62
|
||||
# Value: num average pairscore.
|
||||
a <- unlist(strsplit(a, ""))
|
||||
b <- unlist(strsplit(b, ""))
|
||||
v <- 0
|
||||
for (i in seq_along(a)) {
|
||||
v <- v + MDM[ a[i], b[i] ]
|
||||
}
|
||||
return(v / length(a))
|
||||
}
|
||||
|
||||
orig3FG7 <- toString(aa3FG7)
|
||||
orig2F1C <- toString(aa2F1C)
|
||||
N <- 1000
|
||||
scores3FG7 <- numeric(N)
|
||||
scores2F1C <- numeric(N)
|
||||
for (i in 1:N) {
|
||||
scores3FG7[i] <- averagePairScore(orig3FG7, toString(sample(aa3FG7)))
|
||||
scores2F1C[i] <- averagePairScore(orig2F1C, toString(sample(aa2F1C)))
|
||||
}
|
||||
|
||||
# Plot the distributions
|
||||
hist(scores3FG7,
|
||||
col="#5599EE33",
|
||||
breaks = seq(-1.5, 0, by=0.1),
|
||||
main = "Pairscores for randomly shuffled sequences",
|
||||
xlab = "Average pairscore from BLOSUM 62")
|
||||
hist(scores2F1C,
|
||||
col="#55EE9933",
|
||||
breaks = seq(-1.5, 0, by=0.1),
|
||||
add = TRUE)
|
||||
abline(v = sum(BLOSUM62[1:20, 1:20])/400, col = "firebrick", lwd = 2)
|
||||
legend('topright',
|
||||
c("3FG7 (villin)", "2F1C (OmpG)"),
|
||||
fill = c("#5599EE33", "#55EE9933"), bty = 'n',
|
||||
inset = 0.1)
|
||||
|
||||
# This is an important result: even though we have shuffled significantly biased
|
||||
# sequences, and the average scores trend above the average of the mutation data
|
||||
# matrix, the average scores still remain comfortably below zero. This means
|
||||
# that we can't (in general) improve a high-scoring alignment by simply
|
||||
# extending it with randomly matched residues. We will only improve the score if
|
||||
# the similarity of newly added residues is larger than what we expect to get by
|
||||
# random chance!
|
||||
|
||||
|
||||
# [END]
|
||||
|
||||
5
data/2F1C.fa
Normal file
5
data/2F1C.fa
Normal file
@@ -0,0 +1,5 @@
|
||||
>2F1C:X|PDBID|CHAIN|SEQUENCE
|
||||
EERNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLEN
|
||||
DDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYT
|
||||
FNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFY
|
||||
GYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSFHHHHHH
|
||||
6
data/3FG7.fa
Normal file
6
data/3FG7.fa
Normal file
@@ -0,0 +1,6 @@
|
||||
>3FG7:A|PDBID|CHAIN|SEQUENCE
|
||||
MAEEHHHHHHHHLEVLFQGPGRPKTHTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSK
|
||||
WLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMSIFKGRM
|
||||
VVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADT
|
||||
ISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGRFLATEIPDFNQDDLEEDDVFLLDVWD
|
||||
QVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWSGIHVVPNLSPLSNN
|
||||
Reference in New Issue
Block a user