2020 updates - deactivate for maintenance
This commit is contained in:
@@ -8,7 +8,7 @@
|
||||
# http://steipe.biochemistry.utoronto.ca/abc/index.php/Reference_species_for_fungi
|
||||
#
|
||||
# For the data model, see
|
||||
# https://docs.google.com/drawings/d/1uupNvz18_FYFwyyVPebTM0CUxcJCPDQuxuIJGpjWQWg
|
||||
# https://docs.google.com/presentation/d/13vWaVcFpWEOGeSNhwmqugj2qTQuH1eZROgxWdHGEMr0
|
||||
# For the schema, see dbInit() in ./scripts/ABC-dbUtilities.R
|
||||
#
|
||||
# ==============================================================================
|
||||
|
||||
@@ -1,12 +1,35 @@
|
||||
# ABC-dbUtilities.R
|
||||
|
||||
# tocID <- "scripts/ABC-dbUtilities.R"
|
||||
#
|
||||
# database utilities for ABC learning units
|
||||
#
|
||||
# ==============================================================================
|
||||
#
|
||||
|
||||
|
||||
# ====== PACKAGES ==============================================================
|
||||
#TOC> ==========================================================================
|
||||
#TOC>
|
||||
#TOC> Section Title Line
|
||||
#TOC> -------------------------------------------------
|
||||
#TOC> 1 PACKAGES 32
|
||||
#TOC> 2 FUNCTIONS 50
|
||||
#TOC> 2.01 dbSanitizeSequence() 53
|
||||
#TOC> 2.02 dbConfirmUnique() 88
|
||||
#TOC> 2.03 dbInit() 106
|
||||
#TOC> 2.04 dbAutoincrement() 147
|
||||
#TOC> 2.05 dbAddProtein() 160
|
||||
#TOC> 2.06 dbAddFeature() 180
|
||||
#TOC> 2.07 dbAddTaxonomy() 199
|
||||
#TOC> 2.08 dbAddAnnotation() 215
|
||||
#TOC> 2.09 dbFetchUniProtSeq() 243
|
||||
#TOC> 2.10 dbFetchPrositeFeatures() 267
|
||||
#TOC> 2.11 node2text() 311
|
||||
#TOC> 2.12 dbFetchNCBItaxData() 323
|
||||
#TOC> 2.13 UniProtIDmap() 362
|
||||
#TOC> 3 TESTS 399
|
||||
#TOC>
|
||||
#TOC> ==========================================================================
|
||||
|
||||
|
||||
# = 1 PACKAGES ============================================================
|
||||
|
||||
|
||||
if (! requireNamespace("jsonlite", quietly = TRUE)) {
|
||||
@@ -24,9 +47,10 @@ if (! requireNamespace("xml2", quietly = TRUE)) {
|
||||
}
|
||||
|
||||
|
||||
# ====== FUNCTIONS =============================================================
|
||||
# = 2 FUNCTIONS ===========================================================
|
||||
|
||||
|
||||
# == 2.01 dbSanitizeSequence() =============================================
|
||||
dbSanitizeSequence <- function(s, unambiguous = TRUE) {
|
||||
# Remove FASTA header lines, if any,
|
||||
# flatten any structure that s has,
|
||||
@@ -61,6 +85,7 @@ dbSanitizeSequence <- function(s, unambiguous = TRUE) {
|
||||
}
|
||||
|
||||
|
||||
# == 2.02 dbConfirmUnique() ================================================
|
||||
dbConfirmUnique <- function(x) {
|
||||
# x is a vector of logicals.
|
||||
# returns x if x has exactly one TRUE element.
|
||||
@@ -78,24 +103,27 @@ dbConfirmUnique <- function(x) {
|
||||
}
|
||||
|
||||
|
||||
# == 2.03 dbInit() =========================================================
|
||||
dbInit <- function() {
|
||||
# Return an empty instance of the protein database
|
||||
# Open the link and study the schema:
|
||||
# https://docs.google.com/presentation/d/13vWaVcFpWEOGeSNhwmqugj2qTQuH1eZROgxWdHGEMr0
|
||||
|
||||
db <- list()
|
||||
|
||||
db$version <- "1.0"
|
||||
|
||||
db$protein <- data.frame(
|
||||
ID = numeric(),
|
||||
name = character(),
|
||||
RefSeqID = character(),
|
||||
UniProtID = character(),
|
||||
taxonomyID = numeric(),
|
||||
sequence = character(),
|
||||
stringsAsFactors = FALSE)
|
||||
sequence = character())
|
||||
|
||||
db$taxonomy <- data.frame(
|
||||
ID = numeric(),
|
||||
species = character(),
|
||||
stringsAsFactors = FALSE)
|
||||
species = character())
|
||||
|
||||
|
||||
db$annotation <- data.frame(
|
||||
@@ -103,21 +131,20 @@ dbInit <- function() {
|
||||
proteinID = numeric(),
|
||||
featureID = numeric(),
|
||||
start = numeric(),
|
||||
end = numeric(),
|
||||
stringsAsFactors = FALSE)
|
||||
end = numeric())
|
||||
|
||||
db$feature <- data.frame(
|
||||
ID = numeric(),
|
||||
name = character(),
|
||||
description = character(),
|
||||
sourceDB = character(),
|
||||
accession = character(),
|
||||
stringsAsFactors = FALSE)
|
||||
accession = character())
|
||||
|
||||
return(db)
|
||||
}
|
||||
|
||||
|
||||
# == 2.04 dbAutoincrement() ================================================
|
||||
dbAutoincrement <- function(tb) {
|
||||
# Return a unique integer that can be used as a primary key
|
||||
# Value:
|
||||
@@ -130,6 +157,7 @@ dbAutoincrement <- function(tb) {
|
||||
}
|
||||
|
||||
|
||||
# == 2.05 dbAddProtein() ===================================================
|
||||
dbAddProtein <- function(db, jsonDF) {
|
||||
# Add one or more protein entries to the database db.
|
||||
# Parameters:
|
||||
@@ -142,14 +170,14 @@ dbAddProtein <- function(db, jsonDF) {
|
||||
RefSeqID = jsonDF$RefSeqID[i],
|
||||
UniProtID = jsonDF$UniProtID[i],
|
||||
taxonomyID = jsonDF$taxonomyID[i],
|
||||
sequence = dbSanitizeSequence(jsonDF$sequence[i]),
|
||||
stringsAsFactors = FALSE)
|
||||
sequence = dbSanitizeSequence(jsonDF$sequence[i]))
|
||||
db$protein <- rbind(db$protein, x)
|
||||
}
|
||||
return(db)
|
||||
}
|
||||
|
||||
|
||||
# == 2.06 dbAddFeature() ===================================================
|
||||
dbAddFeature <- function(db, jsonDF) {
|
||||
# Add one or more feature entries to the database db.
|
||||
# Parameters:
|
||||
@@ -161,14 +189,14 @@ dbAddFeature <- function(db, jsonDF) {
|
||||
name = jsonDF$name[i],
|
||||
description = jsonDF$description[i],
|
||||
sourceDB = jsonDF$sourceDB[i],
|
||||
accession = jsonDF$accession[i],
|
||||
stringsAsFactors = FALSE)
|
||||
accession = jsonDF$accession[i])
|
||||
db$feature <- rbind(db$feature, x)
|
||||
}
|
||||
return(db)
|
||||
}
|
||||
|
||||
|
||||
# == 2.07 dbAddTaxonomy() ==================================================
|
||||
dbAddTaxonomy <- function(db, jsonDF) {
|
||||
# Add one or more taxonomy entries to the database db.
|
||||
# Parameters:
|
||||
@@ -178,13 +206,13 @@ dbAddTaxonomy <- function(db, jsonDF) {
|
||||
for (i in seq_len(nrow(jsonDF))) {
|
||||
x <- data.frame(
|
||||
ID = jsonDF$ID[i],
|
||||
species = jsonDF$species[i],
|
||||
stringsAsFactors = FALSE)
|
||||
species = jsonDF$species[i])
|
||||
db$taxonomy <- rbind(db$taxonomy, x)
|
||||
}
|
||||
return(db)
|
||||
}
|
||||
|
||||
# == 2.08 dbAddAnnotation() ================================================
|
||||
dbAddAnnotation <- function(db, jsonDF) {
|
||||
# Add one or more annotation entries to the database db.
|
||||
# Parameters:
|
||||
@@ -205,14 +233,14 @@ dbAddAnnotation <- function(db, jsonDF) {
|
||||
proteinID = pID,
|
||||
featureID = fID,
|
||||
start = as.integer(jsonDF$start[i]),
|
||||
end = as.integer(jsonDF$end[i]),
|
||||
stringsAsFactors = FALSE)
|
||||
end = as.integer(jsonDF$end[i]))
|
||||
db$annotation <- rbind(db$annotation, x)
|
||||
}
|
||||
return(db)
|
||||
}
|
||||
|
||||
|
||||
# == 2.09 dbFetchUniProtSeq() ==============================================
|
||||
dbFetchUniProtSeq <- function(ID) {
|
||||
# Fetch a protein sequence from UniProt.
|
||||
# Parameters:
|
||||
@@ -236,6 +264,7 @@ dbFetchUniProtSeq <- function(ID) {
|
||||
}
|
||||
|
||||
|
||||
# == 2.10 dbFetchPrositeFeatures() =========================================
|
||||
dbFetchPrositeFeatures <- function(ID) {
|
||||
# Fetch feature annotations from ScanProsite.
|
||||
# Parameters:
|
||||
@@ -272,14 +301,14 @@ dbFetchPrositeFeatures <- function(ID) {
|
||||
start = as.numeric(tokens[4]),
|
||||
end = as.numeric(tokens[5]),
|
||||
psID = tokens[6],
|
||||
psName = tokens[7],
|
||||
stringsAsFactors = FALSE))
|
||||
psName = tokens[7]))
|
||||
}
|
||||
}
|
||||
return(myFeatures)
|
||||
}
|
||||
|
||||
|
||||
# == 2.11 node2text() ======================================================
|
||||
node2text <- function(doc, tag) {
|
||||
# an extractor function for the contents of elements
|
||||
# between given tags in an XML response.
|
||||
@@ -291,6 +320,7 @@ node2text <- function(doc, tag) {
|
||||
}
|
||||
|
||||
|
||||
# == 2.12 dbFetchNCBItaxData() =============================================
|
||||
dbFetchNCBItaxData <- function(ID) {
|
||||
# Fetch feature taxID and Organism from the NCBI.
|
||||
# Parameters:
|
||||
@@ -329,6 +359,7 @@ dbFetchNCBItaxData <- function(ID) {
|
||||
|
||||
|
||||
|
||||
# == 2.13 UniProtIDmap() ===================================================
|
||||
UniProtIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
|
||||
# Use UniProt ID mapping service to map one or more IDs
|
||||
# Parameters:
|
||||
@@ -351,8 +382,7 @@ UniProtIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
|
||||
|
||||
if (httr::status_code(response) == 200) { # 200: oK
|
||||
myMap <- read.delim(file = textConnection(httr::content(response)),
|
||||
sep = "\t",
|
||||
stringsAsFactors = FALSE)
|
||||
sep = "\t")
|
||||
myMap <- myMap[ , c(1,3)]
|
||||
colnames(myMap) <- c("From", "To")
|
||||
} else {
|
||||
@@ -366,7 +396,7 @@ UniProtIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
|
||||
}
|
||||
|
||||
|
||||
# ====== TESTS =================================================================
|
||||
# = 3 TESTS ===============================================================
|
||||
|
||||
if (FALSE) {
|
||||
if (! requireNamespace("testthat", quietly = TRUE)) {
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
# ABC-makeScCCnet.R
|
||||
# tocID <- "scripts/ABC-makeScCCnet.R"
|
||||
#
|
||||
# Create a subnetwork of high-confidence yeast genes with a "mitotic cell cycle"
|
||||
# GOSlim annotation.
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
# ABC-writeALN.R
|
||||
# tocID <- "scripts/ABC-writeALN.R"
|
||||
#
|
||||
# ToDo: calculate consensus line
|
||||
# append sequence numbers
|
||||
|
||||
@@ -40,7 +40,7 @@ writeMFA <- function(ali,
|
||||
if (is.na(blockWidth)) {
|
||||
stop("PANIC: parameter \"blockWidth\" must be numeric.")
|
||||
}
|
||||
if (blockWidth < 1){
|
||||
if (! blockWidth > 0){
|
||||
stop("PANIC: parameter \"blockWidth\" must be greater than zero.")
|
||||
}
|
||||
|
||||
@@ -105,7 +105,7 @@ writeMFA <- function(ali,
|
||||
txt <- c(txt, "") # append an empty line for readability
|
||||
}
|
||||
|
||||
writeLines(txt, con= myCon)
|
||||
writeLines(txt, con = myCon)
|
||||
|
||||
}
|
||||
|
||||
|
||||
@@ -357,20 +357,23 @@ parseBLASTalignment <- function(hit) {
|
||||
|
||||
# ==== TESTS ===================================================================
|
||||
|
||||
# define query:
|
||||
# q <- paste("IYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHI", # Mbp1 APSES domain
|
||||
# "LKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQ",
|
||||
# "GTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASP",
|
||||
# sep="")
|
||||
# or ...
|
||||
# q <- "NP_010227" # refseq ID
|
||||
#
|
||||
# test <- BLAST(q,
|
||||
# nHits = 100,
|
||||
# E = 0.001,
|
||||
# rid = "",
|
||||
# limits = "txid4751[ORGN]")
|
||||
# length(test$hits)
|
||||
if (FALSE) {
|
||||
# define query:
|
||||
q <- paste("IYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHI", # Mbp1 APSES domain
|
||||
"LKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQ",
|
||||
"GTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASP",
|
||||
sep="")
|
||||
# or ...
|
||||
q <- "NP_010227" # refseq ID
|
||||
|
||||
test <- BLAST(q,
|
||||
nHits = 100,
|
||||
E = 0.001,
|
||||
rid = "",
|
||||
limits = "txid4751[ORGN]")
|
||||
str(test)
|
||||
length(test$hits)
|
||||
}
|
||||
|
||||
# [END]
|
||||
|
||||
|
||||
Reference in New Issue
Block a user