Maintainance fixes and UniProt API change bugfix

.utilities.R

@@ -93,7 +93,7 @@ pBar <- function(i, l, nCh = 50) {
   ticks <- round(seq(1, l-1, length.out = nCh))
   if (i < l) {
     if (any(i == ticks)) {
-      p <- which(i == ticks)
+      p <- which(i == ticks)[1]  # use only first, in case there are ties
       p1 <- paste(rep("#", p), collapse = "")
       p2 <- paste(rep("-", nCh - p), collapse = "")
       cat(sprintf("\r|%s%s|", p1, p2))

BIN-Data_integration.R

@@ -3,12 +3,13 @@
 # Purpose:  A Bioinformatics Course:
 #              R code accompanying the BIN-Data_integration unit.
 #
-# Version:  1.0
+# Version:  1.0.1
 #
-# Date:     2017  10  08
+# Date:     2018  10  30
 # Author:   Boris Steipe (boris.steipe@utoronto.ca)
 #
 # Versions:
+#           1.0.1  Bugfix: UniProt ID Mapping service API change
 #           1.0    First live version
 #
 #
@@ -29,9 +30,9 @@
 #TOC> ==========================================================================
 #TOC> 
 #TOC>   Section  Title                             Line
-#TOC> -------------------------------------------
+#TOC> -------------------------------------------------
-#TOC>   1        Identifier mapping            45
+#TOC>   1        Identifier mapping                  40
-#TOC>   2        Cross-referencing tables     151
+#TOC>   2        Cross-referencing tables           164
 #TOC> 
 #TOC> ==========================================================================
 
@@ -73,14 +74,14 @@ myQueryIDs <- "NP_010227 NP_00000 NP_011036"
 # the URL of the server and send a list of items labelled as "query" in the body
 # of the request. GET() and POST() are functions from httr.
 
-URL <- "http://www.uniprot.org/mapping/"
+URL <- "https://www.uniprot.org/mapping/"
 response <- POST(URL,
                  body = list(from = "P_REFSEQ_AC",   # Refseq Protein
                              to = "ACC",             # UniProt ID
                              format = "tab",
                              query = myQueryIDs))
 
-response
+cat(content(response))
 
 # We need to check the status code - if it is not 200, an error ocurred and we
 # can't process the result:
@@ -94,6 +95,22 @@ myMappedIDs <- read.delim(file = textConnection(content(response)),
                           stringsAsFactors = FALSE)
 myMappedIDs
 
+# We actually only need columns 1 and 3, and we can also change the names
+# to "From" and "To":
+
+myMappedIDs <- myMappedIDs[ , c(1,3)]
+colnames(myMappedIDs) <- c("From", "To")
+
+myMappedIDs
+
+# If this works as expected, you should see:
+#        From     To
+# 1 NP_010227 P39678
+# 2 NP_011036 P25302
+#
+# ... and note that there are only two entries, because nothing was returned
+# for the dummy "RefSeq ID" NP_00000
+
 # If the query can't be fulfilled because of a problem with the server, a
 # WebPage is returned. But the server status is also returned and we can check
 # the status code. I have lately gotten many "503" status codes: Server Not
@@ -114,7 +131,7 @@ myIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
   #    empty data frame if the mapping was unsuccessful. No rows are returned
   #    for IDs that are not mapped.
 
-  URL <- "http://www.uniprot.org/mapping/"
+  URL <- "https://www.uniprot.org/uploadlists/"
   response <- POST(URL,
                    body = list(from = mapFrom,
                                to = mapTo,
@@ -125,6 +142,8 @@ myIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
     myMap <- read.delim(file = textConnection(content(response)),
                         sep = "\t",
                         stringsAsFactors = FALSE)
+    myMap <- myMap[ , c(1,3)]
+    colnames(myMap) <- c("From", "To")
   } else {
     myMap <- data.frame()
     warning(paste("No uniProt ID mapping returned:",

FND-STA-Probability_distribution.R

@@ -584,8 +584,8 @@ KLdiv(pmfL1, pmfL2)  # 0.1087
 # random samples according to the rL1 distribution, calculate the Kullback
 # Leibler divergence with countsL1, and compare the distribution we get with the
 # value we observed as the difference with discL2. Essentially, this tells us
-# the probability that countsL2 is actually a sample from the L1 function. Here we
+# the probability that countsL2 is actually a sample from the L1 function.
-# go:
+# Here we go:
 
 N <- 1000
 divs <- numeric(N)

RPR-Biostrings.R

@@ -182,7 +182,7 @@ toString(myDNAseq[4:15])
 
 # ==   5.1  Views  =============================================================
 
-# Biostring "Views" are objects that store mutliple substrings of one
+# Biostring "Views" are objects that store multiple substrings of one
 # Biostring object.
 
 (myView <- Views(myDNAseq, start = c(1, 19, 37), end = c(15, 30, 45)))

RPR-FASTA.R

@@ -12,7 +12,8 @@
 #           1.0    New unit.
 #
 #
-# TODO:
+# TODO: Make a simple solution first, then extend it to error checking, and
+#       to handle .mfa files.
 #
 #
 # == DO NOT SIMPLY  source()  THIS FILE! =======================================
@@ -231,7 +232,7 @@ refAPSES[grep("P39678", refAPSES) + 1]  # grep() the string and add 1
 # when working with strings, we can use substr(<string>, <start>, <stop>) to
 # extract substrings, but more often we expand the string into a vector of
 # single characters with strsplit(<string>, ""). strsplit() returns a list,
-# to accommodate that <string> could be a vector of many elements, therafore
+# to accommodate that <string> could be a vector of many elements, therefore
 # we usually unlist() the result if we use it only on a single string.
 
 # Example: How many positive charged residues in "MBP1_SACCE"?
@@ -297,8 +298,8 @@ writeFASTA <- function(s, OUT = stdout(), width = 60) {
 
 }
 
-# Let's try this. We don't define OUT, so the result is written to the console
+# Let's try this. If we don't specify OUT, the result is written to the console
-# by default. Defualt width for sequence is 60 characters
+# by default. Default width for sequence is 60 characters
 
 writeFASTA(refAPSES)
 

RPR-RegEx.R

@@ -63,8 +63,8 @@ IHKYRRIIREGTEMNIEEVDSSLDVILQTLIANNNKNKGAEQIITISNANSHA"
 nchar(s)
 # Must be 969
 
-# Fetch the Uniprot ID by retrieving the first string that appears between two
+# Task: Fetch the Uniprot ID by retrieving the first string that appears between
-# vertical bars in the header line.
+# two vertical bars ("pipes") in the header record.
 #
 
 # Develop the regular expression:

RPR-Unit_testing.R

@@ -107,8 +107,7 @@ expect_error(log(v[1,2]))                # This appears oK, but ...
 expect_error(log(v[1,2]), "non-numeric") # ... it's actually a different error!
 
 # Producing unit tests simply means: we define a function, and then we check
-# whether all test pass. Consider a function that is loaded from your utilities
+# whether all test pass. Consider a function that is loaded on startup:
-# file:
 
 biCode
 

scripts/ABC-dbUtilities.R

@@ -345,7 +345,7 @@ UniProtIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
   #    empty data frame if the mapping was unsuccessful. No rows are returned
   #    for IDs that are not mapped.
 
-  URL <- "http://www.uniprot.org/mapping/"
+  URL <- "https://www.uniprot.org/uploadlists/"
   response <- POST(URL,
                    body = list(from = mapFrom,
                                to = mapTo,
@@ -356,6 +356,8 @@ UniProtIDmap <- function (s, mapFrom = "P_REFSEQ_AC", mapTo = "ACC") {
     myMap <- read.delim(file = textConnection(content(response)),
                         sep = "\t",
                         stringsAsFactors = FALSE)
+    myMap <- myMap[ , c(1,3)]
+    colnames(myMap) <- c("From", "To")
   } else {
     myMap <- data.frame()
     warning(paste("No uniProt ID mapping returned:",