2017-09-21 21:49:55 +00:00
|
|
|
# BLAST.R
|
|
|
|
#
|
|
|
|
# Purpose: Send off one BLAST search and return parsed list of results
|
|
|
|
# This script uses the BLAST URL-API
|
|
|
|
# (Application Programming Interface) at the NCBI.
|
|
|
|
# Read about the constraints here:
|
2017-10-23 16:37:09 +00:00
|
|
|
# https://ncbi.github.io/blast-cloud/dev/api.html
|
2017-09-21 21:49:55 +00:00
|
|
|
#
|
|
|
|
#
|
2017-10-23 16:37:09 +00:00
|
|
|
# Version: 2.1
|
|
|
|
# Date: 2016 09 - 2017 10
|
2017-09-21 21:49:55 +00:00
|
|
|
# Author: Boris Steipe
|
|
|
|
#
|
|
|
|
# Versions:
|
2017-10-23 16:37:09 +00:00
|
|
|
# 2.1 bugfix in BLAST(), bug was blanking non-split deflines;
|
|
|
|
# refactored parseBLASTalignment() to handle lists with multiple hits.
|
2017-09-21 21:49:55 +00:00
|
|
|
# 2.0 Completely rewritten because the interface completely changed.
|
|
|
|
# Code adpated in part from NCBI Perl sample code:
|
|
|
|
# $Id: web_blast.pl,v 1.10 2016/07/13 14:32:50 merezhuk Exp $
|
|
|
|
#
|
|
|
|
# 1.0 first version posted for BCH441 2016, based on BLAST - API
|
|
|
|
#
|
|
|
|
# ToDo:
|
|
|
|
#
|
|
|
|
# Notes: This is somewhat pedestrian, but apparently there are currently
|
|
|
|
# no R packages that contain such code.
|
|
|
|
#
|
|
|
|
# ==============================================================================
|
|
|
|
|
|
|
|
|
|
|
|
if (!require(httr, quietly = TRUE)) {
|
|
|
|
install.packages("httr")
|
|
|
|
library(httr)
|
|
|
|
}
|
|
|
|
|
|
|
|
|
|
|
|
BLAST <- function(q,
|
|
|
|
db = "refseq_protein",
|
|
|
|
nHits = 30,
|
|
|
|
E = 0.1,
|
|
|
|
limits = "",
|
|
|
|
rid = "",
|
|
|
|
quietly = FALSE,
|
|
|
|
myTimeout = 120) {
|
|
|
|
# Purpose:
|
|
|
|
# Basic BLAST search
|
|
|
|
# Version: 2.0
|
|
|
|
# Date: 2017-09
|
|
|
|
# Author: Boris Steipe
|
|
|
|
#
|
|
|
|
# Parameters:
|
|
|
|
# q: query - either a valid ID or a sequence
|
|
|
|
# db: "refseq_protein" by default,
|
|
|
|
# other legal valuses include: "nr", "pdb", "swissprot" ...
|
|
|
|
# nHits: number of hits to maximally return
|
|
|
|
# E: E-value cutoff. Do not return hits whose score would be expected
|
|
|
|
# to occur E or more times in a database of random sequence.
|
|
|
|
# limits: a valid ENTREZ filter
|
|
|
|
# rid: a request ID - to retrieve earleir search results
|
|
|
|
# quietly: controls printing of wait-time progress bar
|
|
|
|
# timeout: how much longer _after_ rtoe to wait for a result
|
|
|
|
# before giving up (seconds)
|
|
|
|
# Value:
|
|
|
|
# result: list of resulting hits and some metadata
|
|
|
|
|
|
|
|
|
|
|
|
EXTRAWAIT <- 10 # duration of extra wait cycles if BLAST search is not done
|
|
|
|
|
|
|
|
results <- list()
|
|
|
|
results$rid <- rid
|
|
|
|
results$rtoe <- 0
|
|
|
|
|
2017-10-23 16:37:09 +00:00
|
|
|
if (rid == "") { # if rid is not the empty string we skip the
|
|
|
|
# initial search and and proceed directly to retrieval
|
|
|
|
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# prepare query, GET(), and parse rid and rtoe from BLAST server response
|
|
|
|
results$query <- paste0("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
|
|
|
"?",
|
|
|
|
"CMD=Put",
|
|
|
|
"&PROGRAM=", "blastp",
|
|
|
|
"&QUERY=", URLencode(q),
|
|
|
|
"&DATABASE=", db,
|
|
|
|
"&MATRIX=", "BLOSUM62",
|
|
|
|
"&EXPECT=", as.character(E),
|
|
|
|
"&HITLIST_SIZE=", as.character(nHits),
|
|
|
|
"&ALIGNMENTS=", as.character(nHits),
|
|
|
|
"&FORMAT_TYPE=Text")
|
|
|
|
|
|
|
|
if (limits != "") {
|
|
|
|
results$query <- paste0(
|
|
|
|
results$query,
|
|
|
|
"&ENTREZ_QUERY=", limits)
|
|
|
|
}
|
|
|
|
|
|
|
|
# send it off ...
|
|
|
|
response <- GET(results$query)
|
|
|
|
if (http_status(response)$category != "Success" ) {
|
|
|
|
stop(sprintf("PANIC: Can't send query. BLAST server status error: %s",
|
|
|
|
http_status(response)$message))
|
|
|
|
}
|
|
|
|
|
|
|
|
txt <- content(response, "text", encoding = "UTF-8")
|
|
|
|
|
|
|
|
patt <- "RID = (\\w+)" # match the request id
|
|
|
|
results$rid <- regmatches(txt, regexec(patt, txt))[[1]][2]
|
|
|
|
|
|
|
|
patt <- "RTOE = (\\d+)" # match the expected completion time
|
|
|
|
results$rtoe <- as.numeric(regmatches(txt, regexec(patt, txt))[[1]][2])
|
|
|
|
|
|
|
|
# Now we wait ...
|
|
|
|
if (quietly) {
|
|
|
|
Sys.sleep(results$rtoe)
|
|
|
|
} else {
|
|
|
|
cat(sprintf("BLAST is processing %s:\n", results$rid))
|
|
|
|
waitTimer(results$rtoe)
|
|
|
|
}
|
|
|
|
|
|
|
|
} # done sending query and retrieving rid, rtoe
|
|
|
|
|
|
|
|
# Enter an infinite loop to check for result availability
|
|
|
|
checkStatus <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
|
|
|
"?",
|
|
|
|
"CMD=Get",
|
|
|
|
"&RID=", results$rid,
|
|
|
|
"&FORMAT_TYPE=Text",
|
|
|
|
"&FORMAT_OBJECT=SearchInfo",
|
|
|
|
sep = "")
|
|
|
|
|
|
|
|
while (TRUE) {
|
|
|
|
# Check whether the result is ready
|
|
|
|
response <- GET(checkStatus)
|
|
|
|
if (http_status(response)$category != "Success" ) {
|
|
|
|
stop(sprintf("PANIC: Can't check status. BLAST server status error: %s",
|
|
|
|
http_status(response)$message))
|
|
|
|
}
|
|
|
|
|
|
|
|
txt <- content(response, "text", encoding = "UTF-8")
|
|
|
|
|
|
|
|
if (length(grep("Status=WAITING", txt)) > 0) {
|
|
|
|
myTimeout <- myTimeout - EXTRAWAIT
|
|
|
|
|
|
|
|
if (myTimeout <= 0) { # abort
|
|
|
|
cat("BLAST search not concluded before timeout. Aborting.\n")
|
|
|
|
cat(sprintf("You could check back later with rid \"%s\"\n",
|
|
|
|
results$rid))
|
|
|
|
return(results)
|
|
|
|
}
|
|
|
|
|
|
|
|
if (quietly) {
|
|
|
|
Sys.sleep(EXTRAWAIT)
|
|
|
|
} else {
|
|
|
|
cat(sprintf("Status: Waiting. Wait %d more seconds (max. %d more)",
|
|
|
|
EXTRAWAIT,
|
|
|
|
myTimeout))
|
|
|
|
waitTimer(EXTRAWAIT)
|
|
|
|
next
|
|
|
|
}
|
|
|
|
|
|
|
|
} else if (length(grep("Status=FAILED", txt)) > 0) {
|
|
|
|
cat("BLAST search returned status \"FAILED\". Aborting.\n")
|
|
|
|
return(results)
|
|
|
|
|
|
|
|
} else if (length(grep("Status=UNKNOWN", txt)) > 0) {
|
|
|
|
cat("BLAST search returned status \"UNKNOWN\".\n")
|
|
|
|
cat("This probably means the rid has expired. Aborting.\n")
|
|
|
|
return(results)
|
|
|
|
|
|
|
|
} else if (length(grep("Status=READY", txt)) > 0) { # Done
|
|
|
|
|
|
|
|
if (length(grep("ThereAreHits=yes", txt)) == 0) { # No hits
|
|
|
|
cat("BLAST search ready but no hits found. Aborting.\n")
|
|
|
|
return(results)
|
|
|
|
|
|
|
|
} else {
|
|
|
|
break # done ... retrieve search result
|
|
|
|
}
|
|
|
|
}
|
|
|
|
} # end result-check loop
|
|
|
|
|
|
|
|
# retrieve results from BLAST server
|
|
|
|
retrieve <- paste("https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi",
|
|
|
|
"?",
|
|
|
|
"&CMD=Get",
|
|
|
|
"&RID=", results$rid,
|
|
|
|
"&FORMAT_TYPE=Text",
|
|
|
|
sep = "")
|
|
|
|
|
|
|
|
response <- GET(retrieve)
|
|
|
|
if (http_status(response)$category != "Success" ) {
|
|
|
|
stop(sprintf("PANIC: Can't retrieve. BLAST server status error: %s",
|
|
|
|
http_status(response)$message))
|
|
|
|
}
|
|
|
|
|
|
|
|
txt <- content(response, "text", encoding = "UTF-8")
|
|
|
|
|
|
|
|
# txt contains the whole set of results. Process:
|
|
|
|
|
|
|
|
# First, we strsplit() on linebreaks:
|
|
|
|
txt <- unlist(strsplit(txt, "\n"))
|
|
|
|
|
|
|
|
# The alignments range from the first line that begins with ">" ...
|
|
|
|
iFirst <- grep("^>", txt)[1]
|
|
|
|
|
|
|
|
# ... to the last line that begins with "Sbjct"
|
|
|
|
x <- grep("^Sbjct", txt)
|
|
|
|
iLast <- x[length(x)]
|
|
|
|
|
|
|
|
# Get the alignments block
|
|
|
|
txt <- txt[iFirst:iLast]
|
|
|
|
|
|
|
|
# Drop empty lines
|
|
|
|
txt <- txt[!(nchar(txt) == 0)]
|
|
|
|
|
|
|
|
# A line that ends "]" but does not begin ">" seems to be a split
|
|
|
|
# defline ... eg.
|
|
|
|
# [1] ">XP_013349208.1 AUEXF2481DRAFT_695809 [Aureobasidium subglaciale "
|
|
|
|
# [2] "EXF-2481]"
|
|
|
|
# Merge these lines to the preceding lines and delete them.
|
|
|
|
#
|
|
|
|
x <- which(grepl("]$", txt) & !(grepl("^>", txt)))
|
2017-10-23 16:37:09 +00:00
|
|
|
if (length(x) > 0) {
|
|
|
|
txt[x-1] <- paste0(txt[x-1], txt[x])
|
|
|
|
txt <- txt[-x]
|
|
|
|
}
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# Special case: there may be multiple deflines when the BLAST hit is to
|
|
|
|
# redundant, identical sequences. Keep only the first instance.
|
|
|
|
iKeep <- ! grepl("^>", txt)
|
|
|
|
x <- rle(iKeep)
|
|
|
|
x$positions <- cumsum(x$lengths)
|
|
|
|
i <- which(x$lengths > 1 & x$values == FALSE)
|
|
|
|
if (length(i) > 0) {
|
|
|
|
firsts <- x$positions[i] - x$lengths[i] + 1
|
|
|
|
iKeep[firsts] <- TRUE
|
|
|
|
txt <- txt[iKeep]
|
|
|
|
}
|
|
|
|
|
|
|
|
# After this preprocessing the following should be true:
|
|
|
|
# - Every alignment block begins with a defline in which the
|
|
|
|
# first character is ">"
|
|
|
|
# - There is only one defline in each block.
|
|
|
|
# - Lines are not split.
|
|
|
|
|
|
|
|
# Make a dataframe of first and last indices of alignment blocks
|
|
|
|
x <- grep("^>", txt)
|
|
|
|
blocks <- data.frame(iFirst = x,
|
|
|
|
iLast = c((x[-1] - 1), length(txt)))
|
|
|
|
|
|
|
|
# Build the hits list by parsing the blocks
|
|
|
|
results$hits <- list()
|
|
|
|
|
|
|
|
for (i in seq_len(nrow(blocks))) {
|
|
|
|
thisBlock <- txt[blocks$iFirst[i]:blocks$iLast[i]]
|
|
|
|
results$hits[[i]] <- parseBLASTalignment(thisBlock)
|
|
|
|
}
|
|
|
|
|
|
|
|
return(results)
|
|
|
|
}
|
|
|
|
|
2017-10-23 16:37:09 +00:00
|
|
|
parseBLASTalignment <- function(hits, idx) {
|
|
|
|
# Parse one BLAST hit from a BLAST result
|
|
|
|
# Parameters:
|
|
|
|
# hits list contains the BLAST hits
|
|
|
|
# idx int index of the requested hit
|
|
|
|
# Value:
|
|
|
|
# list $def chr defline
|
|
|
|
# $accession chr accession number
|
|
|
|
# $organism chr complete organism definition
|
|
|
|
# $species chr binomial species
|
|
|
|
# $E num E value
|
|
|
|
# $lengthAli num length of the alignment
|
|
|
|
# $nIdentitites num number of identities
|
|
|
|
# $nGaps num number of gaps
|
|
|
|
# $Qbounds num 2-element vector of query start-end
|
|
|
|
# $Sbounds num 2-element vector of subject start-end
|
|
|
|
# $Qseq chr query sequence
|
|
|
|
# $midSeq chr midline string
|
|
|
|
# $Sseq chr subject sequence
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
h <- list()
|
|
|
|
|
2017-10-23 16:37:09 +00:00
|
|
|
hit <- hits$hits[[idx]]
|
|
|
|
|
2017-09-21 21:49:55 +00:00
|
|
|
# FASTA defline
|
2017-10-23 16:37:09 +00:00
|
|
|
h$def <- hit$def
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# accesion number (ID), use the first if there are several, separated by "|"
|
|
|
|
patt <- "^>(.+?)(\\s|\\|)" # from ">" to space or "|"
|
|
|
|
h$accession <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
|
|
|
|
|
|
|
|
# organism
|
|
|
|
patt <- "\\[(.+)]"
|
|
|
|
h$organism <- regmatches(h$def, regexec(patt, h$def))[[1]][2]
|
|
|
|
|
|
|
|
# species
|
|
|
|
x <- unlist(strsplit(h$organism, "\\s+"))
|
2017-10-23 16:37:09 +00:00
|
|
|
if (length(x) >= 2) {
|
|
|
|
h$species <- paste(x[1], x[2])
|
|
|
|
} else if (length(x) == 1) {
|
|
|
|
h$species <- paste(x[1], "sp.")
|
2017-09-21 21:49:55 +00:00
|
|
|
} else {
|
2017-10-23 16:37:09 +00:00
|
|
|
h$species <- NA
|
2017-09-21 21:49:55 +00:00
|
|
|
}
|
|
|
|
|
|
|
|
# E-value
|
2017-10-23 16:37:09 +00:00
|
|
|
h$E <- hit$E
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# length of hit and # identities
|
2017-10-23 16:37:09 +00:00
|
|
|
h$lengthAli <- hit$lengthAli
|
|
|
|
h$nIdentities <- hit$nIdentities
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# number of gaps
|
2017-10-23 16:37:09 +00:00
|
|
|
h$nGaps <- hit$nGaps
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# first and last positions
|
2017-10-23 16:37:09 +00:00
|
|
|
h$Qbounds <- hit$Qbounds
|
|
|
|
h$Sbounds <- hit$Sbounds
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
# aligned sequences
|
|
|
|
|
2017-10-23 16:37:09 +00:00
|
|
|
h$Qseq <- hit$Qseq
|
|
|
|
h$midSeq <- hit$midSeq
|
|
|
|
h$Sseq <- hit$Sseq
|
2017-09-21 21:49:55 +00:00
|
|
|
|
|
|
|
return(h)
|
|
|
|
}
|
|
|
|
|
|
|
|
|
|
|
|
# ==== TESTS ===================================================================
|
|
|
|
|
|
|
|
# define query:
|
|
|
|
# q <- paste("IYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHI", # Mbp1 APSES domain sequence
|
|
|
|
# "LKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQ",
|
|
|
|
# "GTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASP",
|
|
|
|
# sep="")
|
|
|
|
# or ...
|
|
|
|
# q <- "NP_010227" # refseq ID
|
|
|
|
#
|
|
|
|
# test <- BLAST(q,
|
|
|
|
# nHits = 100,
|
|
|
|
# E = 0.001,
|
|
|
|
# rid = "",
|
|
|
|
# limits = "txid4751[ORGN]")
|
|
|
|
# length(test$hits)
|
|
|
|
|
|
|
|
# [END]
|
|
|
|
|